KEGG   Ehrlichia chaffeensis Arkansas: ECH_0875Help
Entry
ECH_0875          CDS       T00328                                 

Definition
(GenBank) putative phosphatidylglycerophosphatase A
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA
Motif
Other DBs
NCBI-ProteinID: ABD44836
UniProt: Q2GFW3
Position
complement(894363..895043)
Genome map
AA seq 226 aa AA seqDB search
MKIIGKILPTRLISTFLGTGYLPAWQNHWAAVLSLILGYVLFYLIYGMSYVSYGILVTGA
VVASLFLKISLGLIVISIISIFVFQSNNSADDRSDIIVVQIALGQLLVVALSMPAILAIY
NYLAIFYSKICQNIFMCPSWFNDFMHFLMFFLIPFVFFNILDIIKPWPISSLQILYNNCF
SIVFEGLVLVIYTLIVMYLVAFICFDLTIRDAVALNSYIFTLLKFR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattataggtaaaatattacctactaggttaataagcacgtttttaggtactgga
tatttaccagcatggcagaatcattgggctgcggtcttgtctttaatattgggttatgta
ttattctacttaatatacggaatgtcctatgtatcatatggtatattagtaacaggagct
gtagtagcatcattatttttaaagatatcgttagggctgattgtaatatctattatatca
atttttgtatttcaatctaataactctgctgatgatagaagtgatataatagtagtacaa
atagcattaggacagcttttagtagttgcattgtctatgcctgcaatacttgcaatatat
aactacttggcaatattttatagtaaaatatgtcaaaatatttttatgtgtccttcttgg
tttaatgattttatgcattttttaatgttctttttgatcccttttgtgttttttaatatt
cttgacataataaaaccttggcctatctctagtttgcagatattatataacaattgcttt
tcaatagtttttgaaggactagtgttagtcatttatacattgatagttatgtatcttgta
gcatttatatgttttgacttaactattcgtgatgcagtggctcttaatagttatattttt
actttgctaaaattcaggtaa

DBGET integrated database retrieval system