KEGG   Ehrlichia chaffeensis Arkansas: ECH_0881Help
Entry
ECH_0881          CDS       T00328                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  
acyl carrier protein
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ECH_0881 (acpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
903345..903620
Genome map
AA seq 91 aa AA seqDB search
MESNDEKLESVKDTVTKIVIDCLKLKDEQKATLSGSTNLAKDLNLDSLDFVDLVMCLEDH
FSIEISDEEAQELETIDKIEEYIRNKLSSKN
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaatgacgaaaagttagaatctgtcaaagatactgtgactaaaattgtgatt
gattgtttaaaactaaaagacgaacaaaaagctactctatccggtagcactaatttagca
aaagacttgaatcttgatagccttgatttcgtagatttggtaatgtgcttagaagaccat
ttctccatagaaatttccgatgaagaagcacaagaacttgaaactatagataaaatagaa
gagtatatacgtaataagttatcaagtaagaattga

DBGET integrated database retrieval system