KEGG   Ehrlichia chaffeensis Arkansas: ECH_0886Help
Entry
ECH_0886          CDS       T00328                                 

Gene name
argD
Definition
(GenBank) acetylornithine/succinyldiaminopimelate aminotransferase
  KO
K00821  
acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Arginine biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ECH_0886 (argD)
   00220 Arginine biosynthesis
    ECH_0886 (argD)
Enzymes [BR:ech01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     ECH_0886 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     ECH_0886 (argD)
Amino acid related enzymes [BR:ech01007]
 Aminotransferase (transaminase)
  Class III
   ECH_0886 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
910768..911946
Genome map
AA seq 392 aa AA seqDB search
MNSSPILPVYAPSKVTFSHGKGVYLYDYNNKKYVDFHAGIATSSLGHAHPALVNALKTQG
EKLWHISNVHTIPEAIKLAQKLVDISFADKVFFNNSGAESVECCLKIARSYQCGKGNTQR
YRFITMKQSYHGRTCAACSANDPSKFSPFLKPYVEWFDCVNPDITSIKNAINETIGAILL
EPIQGEGGINVLDDSFLKELRTICDQNDILLIFDCVQCGSGRTGKFFAHEHTGVTPDICC
LAKGLGGGFPISATLATNNASQFMGVGMHGSTFGGNPLATTIGMTVVEEILKDGFLDNVT
KNGHYLYKRLEDLAKKFPVIEEVKGKGLMIGLKINTNINNRELMHDLISCGLLTNTASNN
TLRIVPPLIITQQEIDEGLAILESYLQSKYHQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttcgccaattttacctgtttatgcaccatctaaggttactttctcacatggg
aaaggagtctatttatacgactataataataaaaaatatgtagattttcatgcaggcatt
gcaactagttcgttaggacacgctcatccagcattagtaaatgcattaaaaacacaaggt
gaaaagttatggcacatatcaaatgtacatacaatacctgaagctatcaagttagcacaa
aaattagtagatattagcttcgctgataaagtgttttttaataattcaggtgcagaatct
gtagaatgttgcttaaagatagcaaggtcataccaatgtggtaaaggtaatactcaacgt
tatagattcattacaatgaagcagtcttatcatggaagaacatgtgctgcatgttcagca
aatgatccaagtaaattctctccatttcttaaaccatacgttgaatggtttgactgtgta
aatcctgatatcacatccataaaaaatgcaattaatgaaactataggtgctatactatta
gaacctatacaaggagaaggaggaatcaacgtacttgatgattctttcttgaaagaatta
cgtacaatttgtgatcaaaacgatatactgctaattttcgattgtgtacaatgtggaagt
ggaagaacaggaaaattctttgctcatgagcatactggagtaactcctgacatatgttgt
cttgcaaaaggattaggtggtggtttccctatatcagcaactttagcaaccaataatgct
tctcagtttatgggtgttggcatgcatggttctacttttggaggaaatcctttagcaact
actattggaatgactgtagttgaagaaattttaaaagatgggtttttagacaatgtaact
aaaaatggccattatctgtacaaaaggttggaagatttagctaaaaaatttccagtaatt
gaagaagtaaaaggtaaagggctcatgataggactaaaaatcaatactaatattaataat
agagaattaatgcatgatttaataagttgtgggttactaaccaacactgcaagcaataat
actttaaggatagtacctcctttaatcataactcaacaagaaattgatgaaggtcttgct
atactagaaagttatctgcaaagcaaatatcatcagtaa

DBGET integrated database retrieval system