KEGG   Ehrlichia chaffeensis Arkansas: ECH_0894Help
Entry
ECH_0894          CDS       T00328                                 

Definition
(GenBank) conserved domain protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(920077..920202)
Genome map
AA seq 41 aa AA seqDB search
MKLKNKKDMCSRNGWPIIDVTQKFVEEISATIIQYFNKMQP
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaagaacaaaaaagatatgtgttcacgaaatggctggcctattatagatgtt
acacaaaagtttgttgaagaaatatcagcaacaattattcagtattttaataaaatgcaa
ccttaa

DBGET integrated database retrieval system