KEGG   Ehrlichia chaffeensis Arkansas: ECH_0907Help
Entry
ECH_0907          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_8 PAS_7
Motif
Other DBs
NCBI-ProteinID: ABD44563
UniProt: Q2GFT4
Position
933038..934183
Genome map
AA seq 381 aa AA seqDB search
MFTYITIFLLIFVLGLLINAYYRANINICALKHNNNLINSLLSTLGDGFYLWDEKRRIEK
FSPNLQILLNTVFYSFDEFADFFEESKELQKKFTEAKKVNKSFTIDLKGQDTEIYCSCYG
QSIVDTNGQIIGVLLWVQNITNYKLSITSLEYENTKLKENLLNYTDILNNLPYPLWKRGK
DSKIKTKNLFYSELVQHNLNIDTAHNTRLINKKNNKISQKIQYAIINNERKLYNMVEIPI
KNSNEFIGYGEDITRLNYFAQELKNYTTLQKNLLNNLPNAVAIYNRDGSIIFYNRIFTKF
WQLNSSWLDTHPNYSSILQKIYEDSNLLDKEKFDLINQQQYEIFKQITEPYHGTMVLKDN
TTLKIIVIPNFKQELTFIYNK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttacattaccatttttttgttaatatttgttttaggtttattaatcaatgct
tattatcgtgctaacatcaacatttgtgctctaaaacataataataatcttattaacagt
ttattatcaactttaggagatgggttctacctttgggatgaaaaacggcgtatagaaaaa
ttttctccgaacctacaaattttacttaacactgtattctattcttttgacgaatttgct
gacttttttgaagaatcaaaagaactacaaaaaaagtttactgaagctaaaaaagttaac
aaatcttttactatagacttaaaaggacaagatacagaaatttattgttcttgttatggg
caaagtatagtcgacactaatggacaaatcataggagtcttgctgtgggtacaaaatata
acaaactataaattatcaataacaagcttagaatatgaaaatacaaaattaaaagagaac
ctactaaactacactgacatattaaacaacttaccatatccactatggaaaagagggaaa
gattccaaaattaagactaagaatctattttattctgaacttgtacaacacaacttaaac
atagacacagcccacaatacacgacttatcaataaaaagaacaacaaaattagtcaaaaa
atacaatacgctatcatcaataatgaaagaaagctatacaacatggtagaaatcccaatt
aaaaactcaaatgaatttattggatatggagaagatatcacacgacttaattattttgct
caagaactaaaaaattatactaccctacaaaaaaacttattaaacaaccttccaaatgcc
gtggcaatatacaatagagatggatcaattatattttacaacagaattttcacaaaattt
tggcagttaaattcttcatggctagatactcatccaaactactcaagtattttgcaaaaa
atatacgaagatagtaacctcttagacaaagaaaaatttgacttaataaaccaacaacaa
tatgaaatatttaaacaaattactgaaccataccacggaactatggtattaaaagacaat
actactttaaaaattatagtaatcccaaactttaaacaagaattaacctttatatacaac
aaataa

DBGET integrated database retrieval system