KEGG   Ehrlichia chaffeensis Arkansas: ECH_0908Help
Entry
ECH_0908          CDS       T00328                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(934219..934419)
Genome map
AA seq 66 aa AA seqDB search
MKWNNVDSIAISLEDHYPEHDIFNTRFTELRLMILGLPGFDDDDNGCNEKILESIQLSWY
EERQNK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaataatgttgatagtattgctatatctttagaggaccattacccggaacat
gatatattcaatactagatttacagagttgcgtttaatgattttagggttaccaggtttt
gatgacgatgataatgggtgtaacgaaaagattcttgaatctatacagttgtcttggtat
gaggagcgtcaaaataaataa

DBGET integrated database retrieval system