KEGG   Ehrlichia chaffeensis Arkansas: ECH_0917Help
Entry
ECH_0917          CDS       T00328                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00020  Citrate cycle (TCA cycle)
ech00190  Oxidative phosphorylation
ech00650  Butanoate metabolism
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01120  Microbial metabolism in diverse environments
ech01130  Biosynthesis of antibiotics
ech01200  Carbon metabolism
Module
ech_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ech_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ech_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECH_0917
   00650 Butanoate metabolism
    ECH_0917
  Energy metabolism
   00190 Oxidative phosphorylation
    ECH_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABD45382
UniProt: Q2GFS5
Position
complement(941300..941656)
Genome map
AA seq 118 aa AA seqDB search
MVSHSVYHWLIQRVTAFVLIPLSLWFLFKVLGVISIILKSFPELHLSISNISNTDLIILL
CFFISAFYHAVLGVQVILEDYIHSVVLRASVFLVIKGIVILTVLFLTFIILYSVLLGY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcattcagtttatcattggttaattcaaagggttacggcttttgttttaatt
cctctttctctgtggtttttatttaaggttcttggtgttatttctataatacttaaatct
tttccagaacttcatttgtctatttcaaatataagtaatactgatcttattattttatta
tgcttttttatctctgcattttatcatgcggttctaggtgtacaggttatattagaagat
tatatacattctgttgtgttaagagcatctgtatttcttgttattaaaggaattgtgatt
ttaactgtgttgtttttaacatttataattttatatagtgtactgttaggatattaa

DBGET integrated database retrieval system