KEGG   Ehrlichia chaffeensis Arkansas: ECH_0917Help
Entry
ECH_0917          CDS       T00328                                 

Definition
putative succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECH_0917
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECH_0917
   00650 Butanoate metabolism
    ECH_0917
  Energy metabolism
   00190 Oxidative phosphorylation
    ECH_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(941300..941656)
Genome map
AA seq 118 aa AA seqDB search
MVSHSVYHWLIQRVTAFVLIPLSLWFLFKVLGVISIILKSFPELHLSISNISNTDLIILL
CFFISAFYHAVLGVQVILEDYIHSVVLRASVFLVIKGIVILTVLFLTFIILYSVLLGY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcattcagtttatcattggttaattcaaagggttacggcttttgttttaatt
cctctttctctgtggtttttatttaaggttcttggtgttatttctataatacttaaatct
tttccagaacttcatttgtctatttcaaatataagtaatactgatcttattattttatta
tgcttttttatctctgcattttatcatgcggttctaggtgtacaggttatattagaagat
tatatacattctgttgtgttaagagcatctgtatttcttgttattaaaggaattgtgatt
ttaactgtgttgtttttaacatttataattttatatagtgtactgttaggatattaa

DBGET integrated database retrieval system