KEGG   Ehrlichia chaffeensis Arkansas: ECH_0920Help
Entry
ECH_0920          CDS       T00328                                 

Definition
(GenBank) putative 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ech01100  Metabolic pathways
ech01110  Biosynthesis of secondary metabolites
ech01130  Biosynthesis of antibiotics
ech01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECH_0920
Enzymes [BR:ech01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     ECH_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABD44571
UniProt: Q2GFS3
Position
complement(943957..945243)
Genome map
AA seq 428 aa AA seqDB search
MVIISERIYRISGHVSVLKDSLLSHATLILASQVIGVTKIYDIVFNSDIALTIKSLNSLG
IKIKYNKNSKICTVEGMGVGGFLCSKDILCFNDPSIYMIIGSLSNCPFTSFLHGEVNLNI
SNVMKPLFLMGARFISNNNKLPAALVGCIDMLPIKYTTREDSVKMAIMFAALNTYGTTTI
VGTTAQDSIVNMLQRFNVAIECLVDKNSVISISGQRELYSKNVCIPNDFFCMLSFITVAL
ILKGSEITILDVLFNDKMKNFYKILVKMGGNLFFLNQRKNAVGEEVVDLVVKGSVLQGIE
WLFNENFDIDEYLFIVMIAACAEGITVLSGVLNRTLTDKRLRVVIKQLMKCGVMIEIEAD
RLIIYGHSNNIFDCGTVDACYDFKITVLFLTMGMISNNFIKIKNARKTNDLFAIIELFNK
HGAKIRIA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtgataatatctgagagaatatatcgtatatctggccatgtgagcgtgctgaaagat
agtttgctttcacatgcaacattaatcttagcatctcaggtaataggtgtcactaaaatt
tatgatattgtctttaacagcgatatagcacttactattaaatctttaaattcgcttggt
attaaaattaaatataataaaaatagtaagatttgtactgtagaaggaatgggtgtagga
ggtttcctttgttcaaaagatatattatgttttaatgatccatctatttatatgataata
ggaagtttatctaattgtccttttacatcttttctacatggagaggttaatttaaatatt
agcaatgtaatgaagccattattcttaatgggtgcgagatttatttcaaataataataaa
ttacccgctgctttagttggctgtatagacatgttacctataaaatatacgactagggaa
gatagtgtaaagatggcaataatgtttgctgctttaaatacgtatggtaccacaactata
gttggtactactgctcaagatagcattgtaaatatgttacaacgttttaatgttgcgata
gaatgtttggtggataaaaattcggtaatcagtatatctggtcaacgtgagttatactcc
aagaatgtatgtattcctaacgattttttttgtatgttatcttttataactgtagcattg
attttaaaggggtcagaaatcactatattggatgttttgttcaatgataaaatgaaaaat
ttttataaaattttagtgaaaatggggggaaatcttttctttctaaatcagagaaaaaat
gcagtgggagaagaagttgtagatcttgtggttaaggggagtgttctacaaggaattgag
tggctgttcaatgaaaattttgatattgatgaatatttatttatagtgatgatagctgca
tgtgctgaaggtataacagttttaagtggtgtattaaatagaacacttacagataaaagg
ttaagagtggttattaagcaattgatgaaatgtggggtaatgatagaaatagaagcagat
cgcttaattatttatggtcattctaataatatttttgattgtggtacagtagacgcatgt
tacgattttaaaattacagtgttatttttgaccatgggtatgatttctaataattttatt
aaaataaaaaatgcgagaaaaacaaatgatttgtttgcaataattgagttatttaataaa
catggagcgaaaattagaattgcctaa

DBGET integrated database retrieval system