KEGG   Ehrlichia chaffeensis Arkansas: ECH_0926Help
Entry
ECH_0926          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(950795..950890)
Genome map
AA seq 31 aa AA seqDB search
MLDNTEREYIDRFYENLHIKYLLLMRVLHMG
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
atgttagataatacagaaagagaatatattgataggttttatgagaatttgcacatcaaa
tatttgctcctaatgcgagtattacacatgggttaa

DBGET integrated database retrieval system