KEGG   Ehrlichia chaffeensis Arkansas: ECH_0928Help
Entry
ECH_0928          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2689
Motif
Other DBs
NCBI-ProteinID: ABD45338
UniProt: Q2GFR5
Position
complement(951154..951267)
Genome map
AA seq 37 aa AA seqDB search
MGSFVTVSFIVCSCTSVPDESLKKHQVKYSGYLRNES
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
ttgggttcttttgttacagtaagttttattgtttgttcatgcactagtgttcctgatgaa
agcttaaaaaaacatcaagtaaaatattctggatatttaaggaatgaatcataa

DBGET integrated database retrieval system