KEGG   Ehrlichia chaffeensis Arkansas: ECH_0932Help
Entry
ECH_0932          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
954175..954312
Genome map
AA seq 45 aa AA seqDB search
MYSHYKLVALIFKNNTLAILQHIIIKNIHLHLSDIFYVFPNLQQH
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
ttgtactctcattataaattagtagcattgatttttaagaataacacgttagccatttta
cagcacataataataaaaaatattcacttacacctttcagatattttttatgtatttcct
aatttacagcagcactga

DBGET integrated database retrieval system