KEGG   Ehrlichia chaffeensis Arkansas: ECH_0936Help
Entry
ECH_0936          CDS       T00328                                 

Definition
(GenBank) hypothetical protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
956432..956581
Genome map
AA seq 49 aa AA seqDB search
MKQYNQNISTVTRSKTRSINNYTHNISPYILNNLNDRSLLTEQKTLLHK
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatacaaccaaaacattagcacagtcaccagaagtaaaactaggtccatcaat
aactatactcataatatctctccctatatattaaacaacttaaatgataggtcactactt
actgaacaaaaaacattattgcataaataa

DBGET integrated database retrieval system