KEGG   Ehrlichia chaffeensis Arkansas: ECH_0941Help
Entry
ECH_0941          CDS       T00328                                 

Definition
(GenBank) putative transcriptional activator, Baf family
  KO
K03525  type III pantothenate kinase [EC:2.7.1.33]
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech00770  Pantothenate and CoA biosynthesis
ech01100  Metabolic pathways
Module
ech_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ech00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECH_0941
Enzymes [BR:ech01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     ECH_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pan_kinase DUF4445 DUF5111
Motif
Other DBs
NCBI-ProteinID: ABD45447
UniProt: Q2GFQ3
Position
961175..961945
Genome map
AA seq 256 aa AA seqDB search
MLIAIDIGNTNIKLAICANNKIIKRITISSQSRRTADEYFIYLNSTMNQLNLDYKNINNI
IISSVVPSITKPIIELSQNYFNIDPTILSNHHADIFNIKISLQNKVLGSDRLADIIAASS
LYPHKDLLIIGMGTATVFNLLNKDKCIYGQAIAPGAHILAKSMRQYTALLPEVLISKQDK
VIHDNIYHAMESGIYWGYITMINGMIEKIIKEEEKDLYIIATGGNSNLFFNHKTAIHNIE
VDLTIKGLIQLHTVLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaatagcaatagatataggtaatacaaacataaaattagcaatctgtgcaaacaat
aaaattataaaaaggataactatctcttcacaatctaggagaacagctgatgaatacttc
atatatttaaattctacaatgaatcaattaaaccttgattacaaaaatataaataatatt
atcatatcaagtgtagttccaagtataacaaagccaattatcgaattaagtcaaaattat
tttaatatagatcccacaattttgagtaaccatcatgcagacatttttaatattaagata
agcttacaaaacaaagtattaggatcagataggttagcagatataattgcagcaagcagt
ttatatccccataaagatttactcataataggtatgggaactgcaacagtatttaactta
ttaaataaagataaatgcatatatggacaagctatagcacctggagcacatattttagca
aaaagtatgagacaatacactgccctattaccagaagtattaatttcaaaacaagacaaa
gtaatacatgataatatataccacgcaatggaatcaggaatatactggggatatattacc
atgattaacggaatgattgaaaaaataataaaggaagaggaaaaagatttatatataata
gcaacaggaggaaattctaacttattctttaatcacaaaactgctattcacaacatcgaa
gtagacttaaccataaagggtctcatacaattacatactgtactatcttga

DBGET integrated database retrieval system