KEGG   Ehrlichia chaffeensis Arkansas: ECH_0945Help
Entry
ECH_0945          CDS       T00328                                 

Definition
(GenBank) conserved domain protein
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(963760..967809)
Genome map
AA seq 1349 aa AA seqDB search
MLKYCVTDSSRERSIPQCTTQCDKTSRTITDFNGRKPYMIKRYFVQFGSHKEIIKDLNDR
VRHVYIEMCDLINQLSKEDSRAFFSTLCSSCMTSFFYDLSYLQYDLSIFLGCQSRLLEKV
PNIVISEDTLCKLCEDLVSNYFSINNILLSDAAVSSEQAIESAGSATASTGVGSVSKQQD
MGGGLGVVSDGNTLLIGGQMESVLCVMRQTQNILLRLQRQCHSSNQFMASSVDFPSEQFS
DVKVGIHNFQISLDNMFRILKRLNSVLNIILLENEEKKSEFSAIESSICQNGSDPRLVKV
LILNHMLNQKRSRLSRMSYQSVSSSRERESCDSIDMNETVEHVVLTSEEYSTQFSEISYG
SDECFEENKSGSASSVADGRSIADGLRYDIPLKKPIPVNVVDQKMSGTDVPSCGGECDIH
SSKINDSSSQRFGKYKLNSTSSVADGLRYDIPLKKPIPVNVVDQKMSGTDVPSCGEECDI
HSSKINDSSSQRFGKYKLNSTSSVADGSRYDVPLKMPMPVNIVDQKMSGMNVPSCGEECN
IHSSKIDDSSSQHFGKDKLNSTSSVADGSRYDVPLKKPIPVNVVDQRITDMSVPSTSGET
NVDFFSSIDGHFTITSESGQLVESATLHFGSDVKVECGQSISSNIQSSFVVQDGVTSERD
CISDKMCTLVNHQVFQYMKSEEGRNDLLKILIDDVGGIDRLVKVLVPEIGKDALIDMFPT
MSLFDIESNLSDVVMKDDEGVFIRYCKDGKLKPMHLLQEFISYVNTRNQGEIEETVVSEQ
LHGTISKHLRSNIRSYSRSRDVVLRRSNSARISGEQRFENIMVCQDINVTDDIAGHIKCK
SSDVVLTNSGTRKSQSFRGVSQLYSKERPLLVDYARSYDCSSRQDVSLGCVSSLKRSIFN
KGSNLSCRYVIYNDVMLGDFVKNTFDNLRKSVSTVLKFTDKLSMQDDSILLHWVLFCIIN
NPNFDKCESVIMNDLKSCRLYYKMIISVYHLYYNKITSVPNCQNLLLHVKNLQDMCWVGS
YVKPIHTLFHKGEMKGVYFCVGKDYVKCKIQQYIGTINVSSVAKLREVFKVIDLESITQE
NLDSFVVKDNLIVSFKYFKSASGNCRLDASKYSNVIIKGDIPVHVTLHCNNVFVYGNVKG
RLLSCRDSVRIEGSVSGSIEAKHSGIDTSMVFIAGNVEKSSIVKVENSVVEVCGNVYGNI
EVRSSNVILRGNVYKGSCVVVMLGMYLYFSSIAKGNFFLRGIKHVFINGIIDTSNLCAHE
CNFYIKENRIFKLSNACIDCEVKFLSRDLDVLELQSVMNKKVLERDTESIQTKALCNQAI
NIDQGSHMQQVSHCVHDVKINHLSDLMTI
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatattgtgttactgatagtagtagagaacgttctatcccgcaatgtactact
caatgtgataaaacaagccgtactattactgattttaatggtcgaaagccgtatatgata
aaaagatattttgttcaatttggttctcataaagagattataaaagacttaaatgatagg
gtaagacacgtatatattgaaatgtgtgatcttattaatcagttgtctaaagaagatagt
agggctttcttttctactttgtgctcttcttgtatgacaagttttttttatgacttgagc
tatcttcaatatgacttgagtatttttcttggatgtcaatcgcgtttattggaaaaggta
cctaatattgtaatcagtgaagatacgctgtgtaaattgtgtgaagatcttgtatcgaat
tactttagtattaataatattttgttatcagatgcagctgtttcttcagaacaagcaata
gaaagtgcaggtagtgctactgcttctactggggtaggctctgtaagtaaacagcaagat
atgggtggtggtcttggtgttgttagtgatggtaacacattgttgataggcggacagatg
gaatctgtattatgtgtaatgagacagacgcaaaatattttactaagattgcaacggcaa
tgtcatagttctaatcaatttatggcgagttctgtagattttccttctgaacaatttagc
gatgtaaaagtagggatacataattttcaaatatctctggataatatgtttaggatattg
aaaaggttaaatagtgtgttgaatataatattattggaaaatgaagaaaaaaagtcggaa
ttttcagccatagaatcaagcatatgtcagaatggtagtgaccctagattggttaaagta
ttgattctaaatcatatgttaaatcaaaagagatctagattatctaggatgagttatcaa
agtgtgtctagctcaagagaaagagaatcgtgtgattctatagatatgaatgaaacggtt
gaacatgtggtactaacgagtgaagaatatagtactcaattctcagagattagttatggt
agtgatgaatgttttgaggaaaataaatcaggtagtgctagcagtgtagcagatggcaga
agtatagcagatggcttaagatatgatattcctttgaaaaagcctatacctgtgaatgtt
gttgatcagaagatgagtggtacggatgttccatcatgtggtggggaatgcgatatccat
tcttcaaaaattaatgatagtagtagtcaacgttttggaaagtataagttgaatagtact
agtagtgtagcagatggcttaagatatgatattcctttgaaaaagcctatacctgtgaat
gttgttgatcagaagatgagtggtacggatgttccatcatgtggtgaggaatgcgatatc
cattcttcaaaaattaatgatagtagtagtcaacgttttggaaagtataaattgaatagt
actagtagtgtagcagatggctcaagatatgatgttcctttaaagatgcctatgcctgtg
aatattgttgatcagaagatgagtggtatgaatgttccatcatgtggtgaggaatgcaat
atccattcttcaaaaattgatgatagtagtagtcaacattttggaaaggacaaattgaat
agtactagcagtgtagcagatggctcaagatatgatgttcctttaaaaaagcctatacct
gtgaatgttgttgatcaaagaataactgatatgagtgttccatcaactagtggagaaact
aacgttgatttcttttcgtcaatagatggtcattttactattacaagtgaatctggtcag
ctggtggagtctgcaacgttacactttggttcagatgttaaggtagaatgcggtcagagt
atctcaagtaatatccaaagtagctttgttgtacaagatggagtgactagtgaaagagat
tgtatttctgataagatgtgtacgcttgtaaatcatcaagtatttcagtacatgaaaagt
gaagaaggtaggaatgatttgttaaaaatattgattgatgatgtgggtggtattgatcga
ttagttaaggtattagttccagaaataggtaaggatgctcttatagatatgttccctact
atgtctttatttgatattgaaagtaacctaagtgatgttgttatgaaagatgatgaaggt
gtttttataaggtattgtaaggatggtaaattgaagccaatgcatttattacaagagttt
atctcttatgtgaataccagaaatcagggggaaattgaagagactgtagtatcagaacaa
ttgcatggtactataagtaagcatttgagatctaatataagaagctacagtagaagtaga
gacgttgttttaagaagaagtaattcggctagaataagtggtgaacaacgttttgaaaat
attatggtttgtcaagatattaatgtcacagatgatattgctggtcatataaaatgtaaa
agttcggatgttgtgttaacaaatagtgggactagaaaatcacagtcttttagaggtgta
tctcaattgtattctaaagaacgccctttacttgttgattatgcaagatcatatgactgt
tcaagtagacaagatgtttcacttggttgtgtttcaagtttgaagagatctatatttaac
aaagggagtaatttaagctgtaggtatgtaatttataatgatgttatgttaggggatttt
gtaaaaaatacatttgataatttgcgtaaatctgtcagcacggttttaaagtttacagat
aaactatctatgcaagatgatagtatcttattgcattgggtcttgttctgtataataaat
aacccaaattttgataagtgtgaatctgttattatgaacgatttaaagtcgtgtcgtttg
tattataaaatgattatttcagtatatcatttgtattataacaaaattacttcagtgcct
aattgtcaaaatttacttttacatgttaagaatctacaagatatgtgctgggtaggttct
tatgtgaaacctattcatactttatttcataaaggagaaatgaagggtgtatatttttgt
gttggtaaggattatgtaaaatgtaaaatacaacaatatataggtacgataaatgtaagt
agtgttgctaagttaagagaggtctttaaggttatcgatttagaaagtattactcaagag
aatcttgattcatttgtagtaaaggataatttaattgtctcgtttaagtattttaaatct
gctagtggtaattgtcggttagatgcatctaaatatagtaatgtaattataaaaggtgac
attcctgtacatgtgactttgcattgtaataatgtttttgtatatggtaatgtgaaggga
agattgttgtcgtgtcgtgattcagtaagaattgagggatcagttagtgggagtattgaa
gctaaacacagtggaatagatacatctatggttttcattgcaggtaatgtagaaaaatct
tcaatagtaaaagttgaaaacagtgtagtggaagtttgtggcaatgtttatggtaatatt
gaagtaagaagtagtaatgtcatactaaggggaaatgtatataaaggaagttgtgtagtt
gttatgcttggaatgtatttatatttttcttccattgctaagggtaatttttttctaagg
ggaataaagcacgtatttattaatggaattattgacactagtaatttatgtgcgcatgaa
tgtaatttttatattaaagaaaatagaatatttaaacttagtaatgcatgtatagattgt
gaagtcaagtttttatctcgtgaccttgatgtactagagttacaaagtgtaatgaataaa
aaagtgcttgagagagatactgaaagtatacaaaccaaagctctgtgtaatcaagcaatt
aacatagatcagggtagtcatatgcagcaagttagtcactgtgttcatgatgtcaaaatt
aatcacttgtcagatttaatgacaatatga

DBGET integrated database retrieval system