KEGG   Ehrlichia chaffeensis Arkansas: ECH_0956Help
Entry
ECH_0956          CDS       T00328                                 

Gene name
rplK
Definition
(GenBank) ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
ech03010  Ribosome
Module
ech_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ECH_0956 (rplK)
Ribosome [BR:ech03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECH_0956 (rplK)
  Bacteria
    ECH_0956 (rplK)
  Archaea
    ECH_0956 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11 Ribosomal_L11_N Como_SCP
Motif
Other DBs
NCBI-ProteinID: ABD44685
UniProt: Q2GFN9
Position
complement(981957..982400)
Genome map
AA seq 147 aa AA seqDB search
MSAVLVSKINLMIEAGKANPGPKIASVLGPRGIPMPKFCKEFNDITSGEGKQYKVGDLVT
ARISIYNDKSYSFTISDSPVSYLLKKAAAIDKGSVNPGKDNVGKIKMSAVYEIAKRKMSD
MNADTVEAAAKMVIGTASSMGIVVVEE
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctgttttagtatctaagataaatttgatgatagaagctgggaaagctaatcct
ggacctaaaatagcttctgttttaggacctcgtggtataccaatgcctaagttttgtaaa
gagtttaatgatattacaagtggtgaaggtaagcaatataaagttggtgatctagtcact
gctaggatatctatttataatgataagtcttacagttttacaataagcgattctcctgtg
tcttatttattaaaaaaggctgctgcgattgataaaggttcagtaaatcctggaaaagac
aatgttgggaaaattaaaatgtcagctgtttatgaaatagctaagcgcaagatgtctgat
atgaatgctgatactgtagaagctgcagcgaaaatggttatcggtacagcatcttccatg
ggtattgttgtagtagaagaataa

DBGET integrated database retrieval system