KEGG   Ehrlichia chaffeensis Arkansas: ECH_0956Help
Entry
ECH_0956          CDS       T00328                                 

Gene name
rplK
Definition
(GenBank) ribosomal protein L11
  KO
K02867  
large subunit ribosomal protein L11
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ECH_0956 (rplK)
Ribosome [BR:ech03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECH_0956 (rplK)
  Bacteria
    ECH_0956 (rplK)
  Archaea
    ECH_0956 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(981957..982400)
Genome map
AA seq 147 aa AA seqDB search
MSAVLVSKINLMIEAGKANPGPKIASVLGPRGIPMPKFCKEFNDITSGEGKQYKVGDLVT
ARISIYNDKSYSFTISDSPVSYLLKKAAAIDKGSVNPGKDNVGKIKMSAVYEIAKRKMSD
MNADTVEAAAKMVIGTASSMGIVVVEE
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctgttttagtatctaagataaatttgatgatagaagctgggaaagctaatcct
ggacctaaaatagcttctgttttaggacctcgtggtataccaatgcctaagttttgtaaa
gagtttaatgatattacaagtggtgaaggtaagcaatataaagttggtgatctagtcact
gctaggatatctatttataatgataagtcttacagttttacaataagcgattctcctgtg
tcttatttattaaaaaaggctgctgcgattgataaaggttcagtaaatcctggaaaagac
aatgttgggaaaattaaaatgtcagctgtttatgaaatagctaagcgcaagatgtctgat
atgaatgctgatactgtagaagctgcagcgaaaatggttatcggtacagcatcttccatg
ggtattgttgtagtagaagaataa

DBGET integrated database retrieval system