KEGG   Ehrlichia chaffeensis Arkansas: ECH_0960Help
Entry
ECH_0960          CDS       T00328                                 

Gene name
tuf-1
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ech  Ehrlichia chaffeensis Arkansas
Brite
Translation factors [BR:ech03012]
 Eukaryotic Type
  Elongation factors
   ECH_0960 (tuf-1)
 Prokaryotic Type
   ECH_0960 (tuf-1)
Mitochondrial biogenesis [BR:ech03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECH_0960 (tuf-1)
Exosome [BR:ech04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECH_0960 (tuf-1)
  Exosomal proteins of breast cancer cells
   ECH_0960 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   ECH_0960 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(983263..984450)
Genome map
AA seq 395 aa AA seqDB search
MVEERKPHINVGTIGHVDHGKTTLTAALTTVLAKRLSGEGNKSVKYDEIDKAPEEKARGI
TISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDAAILVVSATDGAMPQTREHIL
LAKQVGVKDIVVWMNKCDVVDDEEMLSLVEMEIRELLSKYGYPGDDIDVVRGSAVKALEE
ETGSGVWSEKIMELMNALEKISLPTREKDKPFLMSIEDVFSIPGRGTVVTGRIERGVIRV
GDKIEIVGLRDIQSTVCTGVEMFHKALDAGEAGDNAGILLRGIKKEDVERGQVLSAPGQI
HSYKKFKAEVYILKKEEGGRHTPFFSNYQPQFYVRTTDVTGSIKLPEGVEMVMPGDNISI
EVSLDKPVAIDKGLRFAIREGGRTVGSGIITEILE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtagaagaaaggaaaccacatataaatgtagggacaatagggcatgttgatcatggt
aagacaacattaacagcagcgttaacaacagtgttagcgaagaggttgagtggagaaggt
aataaaagtgtaaagtatgacgaaatagataaagcaccagaagagaaagcaagaggaata
accatttcaacagcacatgtagaatatgaaacagagaatagacattatgcgcatgtagat
tgtccaggacatgctgattatataaaaaatatgataacaggtgctgcacaaatggatgca
gcaatattagtagtatctgcaacagatggagcaatgccacaaacaagagaacatatacta
ttagcaaaacaagttggagtaaaagatatagtagtatggatgaataagtgtgatgttgta
gatgatgaagaaatgttgtcattagttgagatggaaataagagaattattatcaaaatat
ggatatccaggagatgatatagatgttgtaagaggatctgcagttaaggcattggaagaa
gaaacaggttcaggagtctggagtgaaaaaataatggaattgatgaatgccttagaaaaa
ataagtttaccaacaagagaaaaagataagccatttttaatgtcaatagaagatgtattt
tcaatacctggaagaggtacagtagtaacaggaagaatagagagaggagtaattagagta
ggagataaaatagagatagtagggttacgagatatacagagcacagtatgtacaggtgtt
gaaatgtttcataaagcattagatgcaggagaagcaggggataatgcaggtatattgtta
agaggaataaagaaagaggatgtagagagagggcaagtattgagtgcgcctggtcaaata
cattcgtataagaaatttaaagcagaggtatatatattaaagaaagaagagggaggaagg
catacaccgtttttctcaaattatcagccacaattttatgttagaacaactgatgtaaca
ggtagtataaaattacctgagggggtagagatggtaatgcctggggataatataagtatc
gaagtaagtttagataagcctgttgctattgataaaggattgagatttgcaattcgtgaa
ggtggtagaactgtaggctctggtattattactgaaattttggagtag

DBGET integrated database retrieval system