KEGG   Ehrlichia chaffeensis Arkansas: ECH_0963Help
Entry
ECH_0963          CDS       T00328                                 

Gene name
rpsL
Definition
(GenBank) ribosomal protein S12
  KO
K02950  
small subunit ribosomal protein S12
Organism
ech  Ehrlichia chaffeensis Arkansas
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ech00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ECH_0963 (rpsL)
Ribosome [BR:ech03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    ECH_0963 (rpsL)
  Bacteria
    ECH_0963 (rpsL)
  Archaea
    ECH_0963 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(987058..987429)
Genome map
AA seq 123 aa AA seqDB search
MPTINQLVRKPRKSRSSLNKAPALQHNPQKRAVCVKVYTTTPKKPNSALRKVARVKIAGY
GSEVIAYIPGEGHNLQEHSVILIRGGRVKDLPGVRYHIIRGALDSRGVQNRKKARSKYGV
KKS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaataaatcaattagtccgcaaaccgcgaaaatctcgttcttcattaaataag
gcgcctgcacttcaacataatccgcaaaaaagagcagtgtgtgtaaaagtatatactact
actcctaagaagccaaactcagctttgcgtaaagttgcgcgtgtaaaaattgctggttat
ggtagtgaggttatagcttatatacctggtgaggggcataatttacaggagcattcagtt
atcttaattagaggtgggcgtgtaaaagatttacctggggttcgatatcatattatacgt
ggagcattggattctagaggagtgcaaaataggaagaaggcgcgctcaaagtatggtgtg
aagaaaagttaa

DBGET integrated database retrieval system