KEGG   Ehrlichia chaffeensis Arkansas: ECH_0964Help
Entry
ECH_0964          CDS       T00328                                 

Definition
(GenBank) serine/threonine phosphoprotein phosphatase
Organism
ech  Ehrlichia chaffeensis Arkansas
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 PhoD
Motif
Other DBs
NCBI-ProteinID: ABD45470
UniProt: Q2GFN2
Position
complement(987703..988995)
Genome map
AA seq 430 aa AA seqDB search
MKFVPIKMKYLFICLILLSIPANAKPLFTWSQVVNNNQLSVRAIVLEDEQCPIVNVDDQE
LEMSVRAFPQKGVFNDKVCELLVPQTTSLISIDNVDLPVISRKIRKIAVIGDTGCIVSLW
GTRLSQQHCMSSEEWPLKKILSNISAHNPDLVIHVGDYLYRAVQCIDVERCGNVYGDNSE
TWKADWLDPSMLLSGKAPFLFVRGNHENCDRSYMGWFRYLDPYQYSSSSDRCQNFTDSWE
FNARELDSKNIDFYIFDSSFGNEKNVLDSDIEHLKKQFLPLLKSKSSSVWFLTHRPVWSY
AVLKGKAGNLYYGNLAQQEAFGDLFPDNVSVILSGHVHLSQVLDLKSKKQKHIPMQIIVG
NSGALLHAVPKDMLLFEDVEMGDVVANTVKSDLGFGFTIVEIQESKDVDNVMVTFYNSSG
EKVRQFYTKS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgttccaattaaaatgaaatatctttttatatgtttgattttattatctata
cctgctaatgctaagccattatttacttggtctcaggttgtaaataataatcagttgagt
gttagagctattgttttagaggatgaacagtgtcctatagtaaacgtagatgatcaagaa
ttggaaatgagtgttagagcatttccacaaaaaggagtttttaatgataaagtttgtgaa
ttgttagtgcctcaaacaactagtctgatatctattgataatgtggatcttcctgttata
agtagaaagattaggaaaatagcagttataggagatactggatgtatagtgtcattgtgg
ggtacaagattgagtcagcagcattgtatgtcttcagaagagtggcctttaaaaaagatt
ttatctaacatcagtgcacataatcctgatttggtaattcatgttggtgattatttgtat
agagcagttcaatgtattgatgtcgaaagatgtggtaatgtttatggagataatagtgaa
acatggaaagctgattggttagatccatcaatgttattgtctggtaaggctccattttta
tttgttcggggtaatcatgaaaattgtgatagatcatatatgggatggtttaggtattta
gacccttatcaatattcctcttcttcagataggtgtcaaaattttacagactcatgggag
tttaatgctagagagttagacagtaagaatatagatttttatatttttgattcatctttt
ggcaatgaaaaaaatgttcttgattcagatattgaacatttaaaaaagcaattcttacct
ttgttaaagagtaagtcttcttcggtatggtttttaacacatcgtcctgtgtggtcatat
gctgttttgaaaggtaaagcagggaatctttattatggtaatctagctcagcaagaagct
tttggtgatttgtttcctgataatgtttctgtgattttatcagggcatgtgcatttatct
caggtactagatttaaaatctaagaagcaaaaacatatacctatgcaaataatagttggt
aatagtggagctctgcttcatgctgttcctaaagatatgttattgtttgaggatgttgaa
atgggagatgtagttgcaaatacagtaaaaagtgacttaggttttggttttacgatagtt
gaaatacaagagtcaaaagatgtagataatgttatggttacgttttataattcgtctggt
gaaaaagtcaggcaattttatactaagtcataa

DBGET integrated database retrieval system