KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0529Help
Entry
UTI89_C0529       CDS       T00338                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eci01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(537123..537779)
Genome map
AA seq 218 aa AA seqDB search
MLPLTDGLLKMMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWP
ALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQT
EQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEV
YLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctccccctgaccgacggacttcttaagatgatgaacttcaacaatgttttccgctgg
catttgcccttcctgttcctggtcctgttaaccttccgtgccgccgcagcggacacgtta
ttgattctgggtgatagcctgagcgccgggtatcgaatgtctgctagcgcggcctggcct
gccttgttgaatgataagtggcagagtaaaacgtcggtagtcaatgccagcatcagcggc
gacacctcgcaacaagggctggcgcgccttccggctctgctgaaacagcatcagccgcgc
tgggtgctggtagaactgggcggcaatgacggtttgcgtggttttcagccacaacaaacc
gagcaaacgctgcgccagatattgcaggatgtcaaagccgccaacgctgaaccattgtta
atgcaaatacgtctgcctgcaaactatggtcgccgttataatgaagcctttagcgccatt
taccccaaactcgccaaagagtttgatgttccgctgctgcccttttttatggaagaggtc
tacctcaaaccacaatggatgcaggatgacggtattcatcccaaccgcgacgcccagccg
tttattgccgactggatggcgaagcagttgcagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system