KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0537Help
Entry
UTI89_C0537       CDS       T00338                                 

Gene name
hyi
Definition
hydroxypyruvate isomerase (EC:5.3.1.22)
Orthology
K01816  
hydroxypyruvate isomerase [EC:5.3.1.22]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UTI89_C0537 (hyi)
Enzymes [BR:eci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.22  hydroxypyruvate isomerase
     UTI89_C0537 (hyi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546451..547227
Genome map
AA seq 258 aa AA seqDB search
MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEELKQVLASNKLEHTLHN
LPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPTGFSSEQIHT
TLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALKLIDDVGCCNLKIQYDIY
HMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYEYLFTVIENSDYNGWVGCE
YKPQTTTEAGLRWMDPYR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtttctctgctaatttatcgatgttatttggtgaatatgattttctcgcccgt
tttgagaaagctgcgcagtgtggttttcgcggcgttgaatttatgttcccttatgactac
gacattgaagaattaaaacaggtgctggcgagtaataaactcgaacatacgctgcacaat
ttaccggcaggtgactgggcggcgggcgagcggggtattgcctgtattcctggccgtgaa
gaagagtttcgggatggcgtagcagcagcgattcgttatgctcgtgctctgggtaataaa
aaaattaactgtctggtcggtaaaacgccgactggtttcagcagtgaacagattcacaca
acgcttgtagaaaacctacgttatgctgcgaatatgctgatgaaagaagatattttatta
ctgattgaacctattaaccattttgatattcctggtttccatctcaccggaacccggcag
gcactgaaactgattgacgatgttggttgctgcaatttgaaaattcagtatgacatttat
cacatgcagcggatggaaggtgaattaactaataccatgactcagtgggccgataaaatt
ggtcacctgcaaattgctgataatccgcatcgcggcgaaccgggaaccggagaaattaat
tacgaatatctctttacggtaattgaaaattctgactacaacggttgggttggctgtgaa
tataaaccccaaaccaccacggaagccggtttacgctggatggatccgtaccgttaa

DBGET integrated database retrieval system