KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C0718Help
Entry
UTI89_C0718       CDS       T00338                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00020  Citrate cycle (TCA cycle)
eci00190  Oxidative phosphorylation
eci00650  Butanoate metabolism
eci01100  Metabolic pathways
eci01110  Biosynthesis of secondary metabolites
eci01120  Microbial metabolism in diverse environments
eci01130  Biosynthesis of antibiotics
eci01200  Carbon metabolism
Module
eci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eci_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UTI89_C0718 (sdhD)
   00650 Butanoate metabolism
    UTI89_C0718 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    UTI89_C0718 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABE06211
UniProt: Q1REK3
Structure
PDB: 

Jmol
Position
723148..723495
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system