KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1903Help
Entry
UTI89_C1903       CDS       T00338                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eci00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eci00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1829145..1829696)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGKVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatattgacggtaaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggctgatcgtggttttgtggtg
ctgggattcccgtgtaaccagtttctggagcaagaaccgggtagcgatgaagagattaaa
acttattgcaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgtcatccgctgtatcaaaaattgattgccgcagcgccgactgcagtcgcg
ccggaagagagcggattctatgcccgaatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system