KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1916Help
Entry
UTI89_C1916       CDS       T00338                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C1916 (pfkB)
   01230 Biosynthesis of amino acids
    UTI89_C1916 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UTI89_C1916 (pfkB)
   00030 Pentose phosphate pathway
    UTI89_C1916 (pfkB)
   00051 Fructose and mannose metabolism
    UTI89_C1916 (pfkB)
   00052 Galactose metabolism
    UTI89_C1916 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    UTI89_C1916 (pfkB)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UTI89_C1916 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1841081..1842013
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIIDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctcactcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtattcgaacccggaggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaattgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcatt
caggtggtgccaccaccggtaaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgat
acgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system