KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C1964Help
Entry
UTI89_C1964       CDS       T00338                                 

Gene name
ydjB
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    UTI89_C1964 (ydjB)
Enzymes [BR:eci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     UTI89_C1964 (ydjB)
    3.5.1.-  
     UTI89_C1964 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884134..1884775
Genome map
AA seq 213 aa AA seqDB search
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgcgccctgttactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtgccggaaggtgacagtacggtggatgtcgctaaccgcctgattgactggtgc
cagtcgcgcggtgaagcggttatcgccagtcaggactggcacccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccgggccaactcgacggtttgccacaa
accttctggcccgatcactgtgtgcagaacagtgaaggcgcacaattacatccgttactg
aagcaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaactgcgctcgatgactggttgcgcgct
catgtaatcaatgaattgatcgttatgggtctggctactgactattgcgttaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccacaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system