KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C2314Help
Entry
UTI89_C2314       CDS       T00338                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UTI89_C2314 (galF)
   00052 Galactose metabolism
    UTI89_C2314 (galF)
   00500 Starch and sucrose metabolism
    UTI89_C2314 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    UTI89_C2314 (galF)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UTI89_C2314 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2250499..2251404)
Genome map
AA seq 301 aa AA seqDB search
MDEIMTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVT
HASKNAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILC
ARPAIGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSV
IQTKEPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRI
QLTDAIAELAKKQAVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLS
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaaataatgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcat
atgttgcctgccactaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatg
attcagtacatcgttgacgagattgtggctgcagggatcaaagaaatcctcctggtaact
cacgcgtccaagaacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctc
cttgaacagcgcgtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggc
gtgacaattatgaacgtgcgtcagggcgaacctttaggtttgggccactccattttatgt
gcacgacctgccattggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgac
gacgccagcgccgacccgctgcgctacaaccttgctgccatgattgcgcgctttaacgaa
actggccgcagccaggttctggcaaaacgcatgccgggcgatctctctgaatactccgtc
atccagactaaagaaccgcttgatcgcgaaggtaaagtcagccgcattgttgaatttatc
gaaaaaccggatcagccgcagaccctggactcagacatcatggctgtagggcgttatgtg
ctttctgccgatatttggcctgaactggagcgtactcaacctggagcatggggacgtatt
cagttgactgatgccattgctgagttggcaaaaaaacaagcagttgacgcaatgctgatg
actggggacagttacgactgcggaaagaaaatgggttatatgcaagcgtttgtgaagtat
gggctgcgtaacctaaaagaaggggcgaagttccgtaaagggattgagaagctgttaagc
gaataa

DBGET integrated database retrieval system