KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C2660Help
Entry
UTI89_C2660       CDS       T00338                                 

Definition
lysin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Brite
Enzymes [BR:eci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     UTI89_C2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2621848..2622324)
Genome map
AA seq 158 aa AA seqDB search
MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLK
STAAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRC
SNIWASLPGAGYGQFEHKADNLIAKFKEAGGTVREIEV
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaatcaataatcaacgtaaggcgttcctcgatatgctggcgtggtcagaggga
actgataacggacggcagaaaaccagaaatcatggttatgacgtcattgtaggcggagag
ctatttactgattactccgatcaccctcgcaagcttgtcacgctaaacccaaaactcaaa
tcaacagccgccggacgctaccagcttctttcccgttggtgggatgcctaccgtaagcag
cttggtctgaaagacttctctccgaaaagtcaggacgctgtggcattgcagcagattaaa
gagcgtggcgctttaccgatgattgaccgcggtgatattcgtcaggcaatcgaccgttgc
agcaatatctgggcttcactgccgggcgctggttatggtcagttcgagcataaggctgac
aacctgattgcaaaattcaaagaggctggcggaacggtcagagagattgaggtatga

DBGET integrated database retrieval system