KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3516Help
Entry
UTI89_C3516       CDS       T00338                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eci00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eci00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3450255..3453524
Genome map
AA seq 1089 aa AA seqDB search
MHAVRQSFLPDSAAVYFRDPVKVNAFIRYFLVKFLLNSPAITQTTITMNGSDFSLPGGPM
NRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLLLSGQWNFHFFDHPLQVPE
AFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDNPTGAYQRIFTLSD
GWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKTGDNLLCVRVMQWA
DSTYVEDQDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDATLSCEVVLENLAAS
PVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSAESPYLYHLVMTLK
DADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRKGRAVGMDRVEKDL
QLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDISRITDDPQWE
KVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDDTRLVHYEEDRDAE
VVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFYKHDCIQGHY
VWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTPGPGLKEYKQVIAP
VKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKLRDVAPNSEAPLQI
TLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVPFAPNNARPLTLED
DRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMIDNHKQEYEGLWQP
NHLQIMQEHLRDFVVEQSDDEVLLVSRTVIAPPVFDFGMRCTYIWRIAADGQVNVALSGE
RYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDIWRSTVDAMFENYP
FPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAAQHCNELQRSDDIT
LNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQSLASYEFGAGFFS
TNLHSENKQ
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgctgtccggcaatcgtttttgccggacagtgctgccgtttattttcgtgatcca
gttaaagtaaatgcatttatccgctactttttagtaaaatttttactaaactccccagca
attacacaaactaccatcaccatgaatggttccgatttctctctaccgggaggccctatg
aatcgctgggaaaacattcagctcacccacgaaaaccgacttgcgccgcgtgcgtacttt
ttttcatatgattctgttgcgcaggctcgtacttttgcccgtgaaaccagcagcctgttt
ctgctcttaagcggtcagtggaatttccacttttttgaccatccgctgcaagtgccagaa
gccttcacctctgagttaatggctgactgggggcatattaccgtccccgccatgtggcaa
atggaaggtcacggcaaactgcaatataccgacgaaggttttccgttccccatcgatgtg
ccgtttgtccccagcgataacccaaccggtgcctatcaacgtattttcaccctcagcgac
ggctggcagggtaaacagacgctgattaaatttgacggcgtcgaaacctattttgaagtc
tacgttaacggtcagtatgtggggttcagcaagggcagtcgcctgaccgcagagtttgac
atcagcgcgatggttaaaaccggcgacaacctgttgtgtgtgcgtgtgatgcaatgggcg
gactctacctacgtggaagaccaggatatgtggtggtcggcggggattttccgcgatgtt
tatctgatcggaaaacaactcacgcatattaacgatttcaccgttcgtaccgactttgac
gaagcctattgcgatgccacactttcctgcgaagtggtgctggaaaatctcgccgcctcc
cctgtcgtcacgacgctggaatataccctgtttgatggcgaacacgtggtgcacagcagc
gccattgatcatttggcaattgaaaaactgaccagcgccagttttgcttttactgtcgaa
cagccgcagcaatggtcagcagaatccccttatctttaccatctggtcatgacgctgaaa
gacgccgacggcaacgttctggaagtggtgccacaacgcgttggcttccgtgatatcaaa
gtgcgcgacggtctgttctggatcaataaccgttatgtgatgctgcatggcgtcaaccgc
cacgacaacgatcatcgcaaaggccgcgccgttgggatggatcgcgtcgagaaagatctc
cagttgatgaagcagcacaacatcaactccgtgcgtaccgctcactacccgaacgatcca
cgtttttacgaactgtgcgatatctacggcctgtttgtgatggcggaaaccgacgtcgaa
tcgcacggctttgctaatgtcggcgatatcagccgtattaccgacgatccgcagtgggaa
aaagtctacgtcgagcgcattgttcgccatattcacgcgcagaaaaaccatccgtcgatc
atcatctggtcgctgggcaatgaatccggctatggctgtaacatccgcgcgatgtaccat
gcggcgaaggcgctggatgacacgcgactggtgcattacgaagaagatcgcgatgctgaa
gtggtcgatattatttccaccatgtacacccgcgtgcctctgatgaatgagtttggtgaa
tacccgcatccgaagccgcgcatcatctgtgaatatgctcatgcgatggggaacggaccg
ggcgggctgacggagtaccagaacgtcttctataagcacgattgcattcagggacattat
gtctgggaatggtgcgaccacgggatccaggcgcaggatgacaacggcaacgtctggtac
aaattcggcggcgactacggcgactatcccaacaactataacttctgtcttgatggtttg
atctattccgatcagacgccgggaccaggcctgaaagagtacaaacaggttattgcgccg
gtaaaaatccacgcgctggatctgactcgcggcgagttgaaagtcgaaaataaactgtgg
tttaccacgcttgatgactacaccctgcacgcagaggtgcgcgccgaaggtgaaacgctc
gcgacgcaacagattaaactgcgcgacgttgcgccgaacagcgaagcccccttacagatc
acgctgccgcagctggacgcccgcgaagcgttcctcaacattacggtgaccaaagattcc
cgcacccgctacagcgaagccgggcattctatcgccacttatcagttcccgctgaaggaa
aacaccgcgcagcctgtacctttcgcaccgaataacgcccgtccgctgacgctggaagac
gatcgtttgagctgtactgttcgcggctacaactttgcgatcaccttctcaaaaacgagt
ggtaaaccgacatcctggcaagtgaatggcgagtcgctgctgacccgcgagccaaagatc
aacttcttcaagccgatgatcgacaaccataagcaggagtacgaagggctgtggcagcca
aatcatttgcagatcatgcaggagcatctgcgcgattttgtcgttgagcaaagtgatgat
gaagtgttgctagtcagccgcacggttattgccccaccggtgtttgacttcgggatgcgc
tgcacctacatctggcgcatcgctgccgatggccaggttaatgtggcgctttccggtgaa
cgttatggcgactatccgcacatcattccgtgcatcggtttcaccatgggaattaacggc
gaatacgaccaggtggcgtattacggacgtggaccgggcgaaaactacgccgacagccag
caggctaacatcattgatatctggcgcagtaccgtcgatgccatgttcgagaactatccc
ttcccgcagaacaacggcaaccgtcagcatgtccgctggacggcactgactaatcgccac
ggcaacggtctgctggtggttccgcagcgaccaattaacttcagcgcctggcactatacc
caggaaaacatccacgctgcacagcactgtaacgagcttcagcgcagtgatgacatcacc
ctgaatctcgaccaccagttgcttggcctcggctctaactcctggggcagcgaggtgctg
gactcctggcgcgtctggttccgtgacttcagctacggctttacgttgctgccggtttct
ggcggagaagctaccgcgcaaagcctggcgtcgtatgagttcggcgcagggttcttttcc
acgaatttgcacagcgagaataagcaatga

DBGET integrated database retrieval system