KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3609Help
Entry
UTI89_C3609       CDS       T00338                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase (EC:2.5.1.15)
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UTI89_C3609 (folP)
Enzymes [BR:eci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     UTI89_C3609 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3543893..3544807)
Genome map
AA seq 304 aa AA seqDB search
MYRKPRGVLRGFFLSIHTRDNIMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLL
DAVKHANLMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTS
KPEVIRESAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVF
AEVNRYFIEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGM
SRKSMIGQLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKEN
KRYE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccgaaaaccccggggcgtgctccggggttttttcttatcaattcataccagggat
aacatcatgaaactctttgcccagggtacttcactggaccttagccatcctcacgtaatg
gggatcctcaacgtcacgcctgattccttttcggatggtggcacgcataactcgctgtta
gatgcggtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggt
ggcgagtccacgcgcccaggggcggcggaagttagcgttgaagaagagttgcaacgtgtt
attcctgtggttgaggcaattgctcaacgcttcgaagtctggatctcggtagatacatcc
aaaccagaagtcatccgtgagtcagcgaaagttggcgctcacattattaacgatatccgc
tccctttccgaacctggtgctctggaggcggctgcagaaaccggtttaccggtttgtctg
atgcatatgcagggaaatccaaaaaccatgcaggaagcgccgaagtatgacgatgtcttt
gcagaagtgaatcgctactttattgagcaaatagcacgttgcgagcaggcgggtatcgca
aaagagaaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactat
tcattactggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatg
tcacgaaaatcgatgattgggcaattgctgaacgtggggccgtccgagcgcctgagcggt
agtctggcctgtgcggtcattgccgcaatgcaaggcgcgcacatcattcgtgttcatgac
gtcaaagaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaac
aaacgctatgagtaa

DBGET integrated database retrieval system