KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4063Help
Entry
UTI89_C4063       CDS       T00338                                 

Gene name
yhjM
Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UTI89_C4063 (yhjM)
Enzymes [BR:eci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     UTI89_C4063 (yhjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3955774..3956886)
Genome map
AA seq 370 aa AA seqDB search
MKMNVLRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQS
YGMFFALAANDRAAFDNLLDWTQNNLAQGSLKEHLPAWLWGKKENSKWEVLDSNSASDGD
VWMAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRF
NPSYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTL
ISSYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPV
GFSAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLP
DWGQECANSH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatgaatgtgttgcgtagtggactcgtgacgatgctgctgctggctgcctttagt
gttcaggcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcag
gaagggcgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagt
tacggcatgttctttgccctggcggctaacgaccgtgcagctttcgataatcttctcgac
tggacgcagaacaatctcgctcagggttctttaaaagaacatttgcccgcctggctgtgg
ggcaagaaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgat
gtctggatggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttatacc
gacatcggcagcgcattgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctggg
ctgggctccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgtttt
aaccccagctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtgg
accacgctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcg
ccagactgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattg
atcagcagctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgat
ccgcaaaaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaac
ggttatccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtc
ggtttttctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgc
cagcgcgtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctg
tttggacaaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacct
gactggggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system