KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4193Help
Entry
UTI89_C4193       CDS       T00338                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UTI89_C4193 (gmk)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     UTI89_C4193 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4079903..4080583
Genome map
AA seq 226 aa AA seqDB search
MYNKLVCRLYFANHIRKILMAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTT
RQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFL
DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYA
EYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLAD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgtataataagctcgtatgtaggctttatttcgctaatcacatacgaaagatactcatg
gctcaaggcacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctgatt
caggctttattaaaaacccaaccgttgtatgacacccaggtttctgtttcacacaccaca
cgccaaccgcgtcctggtgaagtccacggtgaacattatttctttgttaatcatgatgaa
tttaaagaaatgattagtagagatgcgttcctcgaacacgcagaagtttttggtaattac
tatggcacttcgcgtgaggccattgagcaagtactggcgaccggtgtcgatgtttttctc
gatatcgactggcagggtgcgcagcaaattcgccagaagatgccgcacgcgcggagtatc
tttattttaccgccgtctaaaatcgaactggaccgccgtctacgcggtcgcggtcaggac
agcgaagaggtcattgcaaagcgtatggcgcaagctgttgcagaaatgagccattacgcc
gaatatgattacctgattgtgaatgatgacttcgataccgcgttgaccgatttgaagacc
attattcgcgccgaacgtctgcgcatgagccgccaaaagcagcgtcatgacgctttaatc
agcaaattgttggcagactga

DBGET integrated database retrieval system