KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4431Help
Entry
UTI89_C4431       CDS       T00338                                 

Gene name
fadB
Definition
(GenBank) multifunctional protein; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00071  Fatty acid degradation
eci00280  Valine, leucine and isoleucine degradation
eci00281  Geraniol degradation
eci00310  Lysine degradation
eci00362  Benzoate degradation
eci00380  Tryptophan metabolism
eci00410  beta-Alanine metabolism
eci00640  Propanoate metabolism
eci00650  Butanoate metabolism
eci00903  Limonene and pinene degradation
eci00930  Caprolactam degradation
eci01040  Biosynthesis of unsaturated fatty acids
eci01100  Metabolic pathways
eci01110  Biosynthesis of secondary metabolites
eci01120  Microbial metabolism in diverse environments
eci01130  Biosynthesis of antibiotics
eci01200  Carbon metabolism
eci01212  Fatty acid metabolism
Module
eci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UTI89_C4431 (fadB)
   00650 Butanoate metabolism
    UTI89_C4431 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    UTI89_C4431 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    UTI89_C4431 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UTI89_C4431 (fadB)
   00310 Lysine degradation
    UTI89_C4431 (fadB)
   00380 Tryptophan metabolism
    UTI89_C4431 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UTI89_C4431 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UTI89_C4431 (fadB)
   00281 Geraniol degradation
    UTI89_C4431 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UTI89_C4431 (fadB)
   00930 Caprolactam degradation
    UTI89_C4431 (fadB)
Enzymes [BR:eci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     UTI89_C4431 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UTI89_C4431 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     UTI89_C4431 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     UTI89_C4431 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE09848
UniProt: Q1R466
Position
complement(4315111..4317426)
Genome map
AA seq 771 aa AA seqDB search
MISAERDQIGISLIFYLHIFNTKYTLRCIWYDQITLRIQETDMLYKGDTLYLDWLEDGIA
ELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAI
AILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAV
LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELAN
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDVVVDDLLAKVSQP
KRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTL
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgccgagcgtgatcagatcggcatttccttaatattttatttgcatattttt
aacacaaaatacacacttcgatgcatctggtacgaccagatcaccttgcggattcaggag
actgacatgctttacaaaggcgacaccctttaccttgactggctggaagatggcattgcc
gaactggtatttgataccccaggttcagttaataaactcgacactgcgaccgtcgccagc
ctcggcgaggccatcggcgtgctggaacagcaatcagatctaaaaggactgctgctacgt
tcgaacaaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctc
gttcctgaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctg
gaagatctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgc
gaatgcgtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccg
gaaaccaaattgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctg
ggcgctgacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcg
ctgaaaatcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggggcgata
gcgattttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaag
ctggaaccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaaggg
atggtcgcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccatt
gaagctgcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtc
ccgctggcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatat
gtaaaaggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtg
ctgggcgcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccg
gttgtcatgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaa
ctgctgaacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatc
tccacaattcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaa
gcggttgttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagta
cgcccggataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaac
gcgctggaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatg
ccgttggtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtc
gcctgggcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttc
gtcaaccgtgtgctgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcg
ggtttccgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggca
tatctgctggatgttgtgggcattgacaccgcgcatcacgctcaggctgtcatggcagca
ggcttcccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgcc
aaccgctttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggt
aagccgaagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccg
aagcgcgatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaa
gtggtccgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctc
ggcagcgcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaa
gtaccggaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgag
ccagcccgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system