KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4431Help
Entry
UTI89_C4431       CDS       T00338                                 

Gene name
fadB
Definition
(GenBank) multifunctional protein; 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 5.3.3.8 5.1.2.3 4.2.1.17)
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C4431 (fadB)
   01212 Fatty acid metabolism
    UTI89_C4431 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UTI89_C4431 (fadB)
   00650 Butanoate metabolism
    UTI89_C4431 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    UTI89_C4431 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    UTI89_C4431 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UTI89_C4431 (fadB)
   00310 Lysine degradation
    UTI89_C4431 (fadB)
   00380 Tryptophan metabolism
    UTI89_C4431 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UTI89_C4431 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UTI89_C4431 (fadB)
   00281 Geraniol degradation
    UTI89_C4431 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UTI89_C4431 (fadB)
   00930 Caprolactam degradation
    UTI89_C4431 (fadB)
Enzymes [BR:eci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     UTI89_C4431 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UTI89_C4431 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     UTI89_C4431 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     UTI89_C4431 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4315111..4317426)
Genome map
AA seq 771 aa AA seqDB search
MISAERDQIGISLIFYLHIFNTKYTLRCIWYDQITLRIQETDMLYKGDTLYLDWLEDGIA
ELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAI
AILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAV
LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELAN
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDVVVDDLLAKVSQP
KRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTL
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgccgagcgtgatcagatcggcatttccttaatattttatttgcatattttt
aacacaaaatacacacttcgatgcatctggtacgaccagatcaccttgcggattcaggag
actgacatgctttacaaaggcgacaccctttaccttgactggctggaagatggcattgcc
gaactggtatttgataccccaggttcagttaataaactcgacactgcgaccgtcgccagc
ctcggcgaggccatcggcgtgctggaacagcaatcagatctaaaaggactgctgctacgt
tcgaacaaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctc
gttcctgaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctg
gaagatctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgc
gaatgcgtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccg
gaaaccaaattgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctg
ggcgctgacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcg
ctgaaaatcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggggcgata
gcgattttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaag
ctggaaccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaaggg
atggtcgcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccatt
gaagctgcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtc
ccgctggcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatat
gtaaaaggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtg
ctgggcgcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccg
gttgtcatgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaa
ctgctgaacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatc
tccacaattcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaa
gcggttgttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagta
cgcccggataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaac
gcgctggaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatg
ccgttggtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtc
gcctgggcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttc
gtcaaccgtgtgctgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcg
ggtttccgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggca
tatctgctggatgttgtgggcattgacaccgcgcatcacgctcaggctgtcatggcagca
ggcttcccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgcc
aaccgctttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggt
aagccgaagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccg
aagcgcgatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaa
gtggtccgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctc
ggcagcgcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaa
gtaccggaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgag
ccagcccgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system