KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4499Help
Entry
UTI89_C4499       CDS       T00338                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C4499 (pfkA)
   01230 Biosynthesis of amino acids
    UTI89_C4499 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UTI89_C4499 (pfkA)
   00030 Pentose phosphate pathway
    UTI89_C4499 (pfkA)
   00051 Fructose and mannose metabolism
    UTI89_C4499 (pfkA)
   00052 Galactose metabolism
    UTI89_C4499 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    UTI89_C4499 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UTI89_C4499 (pfkA)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UTI89_C4499 (pfkA)
Protein phosphatases and associated proteins [BR:eci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UTI89_C4499 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4384418..4385476
Genome map
AA seq 352 aa AA seqDB search
MLYYLHIRWIISMCKKTSGNRFHFAFQSSEVVMIKKIGVLTSGGDAPGMNAAIRGVVRSA
LTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDENIRAVAIE
NLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFFTALSTVV
EAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEIKA
GIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRATVLGHIQRGGSPVPYDRILASRM
GAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAIENMKRPFKGDWLDCAKKLY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgttatactatttgcacattcgttggatcatttcgatgtgcaagaagacttccggcaac
agatttcattttgcattccaaagttcagaggtagtcatgattaagaaaatcggtgtgttg
acaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgttctgcg
ctgacagaaggtctggaagtaatgggcatttatgacggctatctgggtctgtatgaagac
cgtatggtacagctagaccgttacagcgtttctgacatgatcaaccgtggtggtacgttc
ctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggctatcgaa
aacctgaaaaaacgtgggatcgacgcgctggtggttatcggcggtgacggttcctacatg
ggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggcctgccgggcactatcgac
aacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcaccgttgta
gaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtggtggaa
gtgatgggccgttattgtggcgatctgacgttggctgcggccattgccggtggctgtgaa
ttcgttgtggttccggaagttgaattcagccgtgaagacctggtaaacgaaatcaaagcg
ggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattactgaacatatgtgtgatgtt
gacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaactgtgctg
ggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcccgtatg
ggcgcttacgctatcgatctgctgctggcaggttacggtggtcgttgcgtaggtatccag
aacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgtccgttc
aaaggcgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system