KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4503Help
Entry
UTI89_C4503       CDS       T00338                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C4503 (tpiA)
   01230 Biosynthesis of amino acids
    UTI89_C4503 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UTI89_C4503 (tpiA)
   00051 Fructose and mannose metabolism
    UTI89_C4503 (tpiA)
   00562 Inositol phosphate metabolism
    UTI89_C4503 (tpiA)
Enzymes [BR:eci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UTI89_C4503 (tpiA)
Exosome [BR:eci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UTI89_C4503 (tpiA)
  Exosomal proteins of bladder cancer cells
   UTI89_C4503 (tpiA)
  Exosomal proteins of melanoma cells
   UTI89_C4503 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4387702..4388469)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtatctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgtgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggccactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggt
ctgactccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaactgaa
gaagtttgtgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacattgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcggaa
ctgtttgctcagccagacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgccgtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system