KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4510Help
Entry
UTI89_C4510       CDS       T00338                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UTI89_C4510 (glpK)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UTI89_C4510 (glpK)
Exosome [BR:eci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UTI89_C4510 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4392712..4394325)
Genome map
AA seq 537 aa AA seqDB search
MVAICLAISVLWKKRRPQLLQNKKLRCNMTTGQLNMTEKKYIVALDQGTTSSRAVVMDHD
ANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTLVEVLAKADISSDQIAAIGITNQRE
TTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWI
LDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLDWDDKML
EVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPISGIAGDQQAALFGQLCVKEGMAKNT
YGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNYALEGAVFMAGASIQWLRDEMKLIN
DAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESI
AYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQFQSDILGTRVERPEVREVTALGAA
YLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERNYRYAGWKKAVKRAMAWEEHDE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgccatttgccttgcgatatctgtgttgtggaagaaaaggagaccacaactcctt
cagaacaaaaagcttcgctgtaatatgactacgggacaattaaacatgactgaaaaaaaa
tatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtcgtaatggatcacgat
gccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctacccaaaaccaggctgg
gtagaacacgacccaatggaaatctgggccacccaaagctccacgctggtagaagtgctg
gcgaaagccgatatcagttccgatcagattgcagctatcggtattacgaaccagcgtgaa
accactattgtctgggaaaaagaaaccggcaagcctatctataacgccattgtctggcag
tgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggtttagaagattatatc
cgcagcaataccggtctggtgattgacccgtatttctctggcaccaaagtgaagtggatc
ctcgaccatgtggaaggctctcgcgagcgtgcgcgtcgtggtgaattgctgtttggtacg
gttgatacgtggcttatctggaaaatgactcagggccgtgtccatgtgaccgattacacc
aacgcctctcgtaccatgttgttcaacatccataccctggactgggacgacaaaatgctg
gaggtgctggatattccgcgtgagatgctgccagaagtgcgtcgttcttccgaagtatac
ggtcagactaacattggcggcaaaggcggcacgcgtattccaatctccgggatcgccggt
gaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaagggatggcgaagaatacc
tacggcactggctgctttatgctgatgaacaccggcgagaaagcggtgaaatcagaaaac
ggcctgctgaccaccatcgcctgcggcccgactggcgaagtgaactatgcgctggaaggt
gcagtgtttatggcgggcgcgtccattcagtggctgcgcgatgagatgaagttgattaac
gacgcctacgattccgaatatttcgccaccaaagtgcaaaacaccaatggtgtgtatgtg
gttccggcctttaccgggctgggtgcgccatactgggatccgtatgcacgcggggcgatt
ttcggtctgactcgtggggtgaacgctaaccacattatacgcgcgacgctggagtctatt
gcttatcagacgcgtgacgtgctggaagcaatgcaggccgactccggtattcgtctgcac
gcgctgcgcgtggacggcggtgcggtggcgaacaatttcctgatgcagttccagtccgat
attctcggtacgcgcgttgagcgcccggaagtgcgcgaagtcaccgctttgggtgcggcc
tatcttgctggtctggcggttggcttctggcagaatcttgacgagctgcaagagaaagcg
gtgattgaacgcgagttccgtccaggcatcgaaaccactgagcgtaattaccgttacgca
ggctggaaaaaagcggtcaaacgcgcgatggcatgggaagaacacgacgagtaa

DBGET integrated database retrieval system