KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4573Help
Entry
UTI89_C4573       CDS       T00338                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C4573 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UTI89_C4573 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    UTI89_C4573 (aceB)
Enzymes [BR:eci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UTI89_C4573 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4463686..4465305
Genome map
AA seq 539 aa AA seqDB search
MTRSCTMTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQ
QQDIDNGMLPDFISETASIRDADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVF
MADFEDSLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAED
RFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRV
LPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKS
LEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKALFRQMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggagctgcacgatgactgaacaggcaacaacaatcgatgaactggcttttaca
aggccgtatggcgagcaggagaagcaaattcttactgccgaagcggtagaatttctgact
gagctggtgacgcattttacgccacaacgcaataaacttctggcagcgcgtattcagcag
cagcaggatatcgataacggaatgttgcctgattttatttcggaaacagcttccattcgt
gatgctgactggaaaattcgcgggattccttcggacttagaagatcgtcgcgtagagatt
accggacctgtagagcgcaagatggtgatcaacgcgctcaacgccaatgtgaaagtcttt
atggccgatttcgaagattcactggcaccagactggaacaaagtgatcgatgggcaaatt
aacctgcgcgatgcggttaacggcaccatcagctatagcaatgaagcaggcaaaatttat
cagctcaagcccaatccagcggttttgatttgtcgggtacgcggtctgcacttgccggaa
aaacatgtcacctggcgtggtgagacaatccccggtagcctgtttgattttgcgctctat
ttcttccacaactatcaggcactgttggcaaagggcagcggtccctatttctatctgccg
aaaacccagtcctggcaggaagcggcctggtggagcgaagtcttcagctatgcagaagat
cgctttaatctgccgcgcggcaccatcaaggcgacgttgctgattgaaacgctgcccgcc
gtgttccagatggatgaaatccttcacgcgctgcgtgaccatattgttggtctgaactgc
ggtcgttgggattacatcttcagttatatcaaaacattgaaaaactatcccgatcgcgtc
ctgccagacagacaggcagtgacgatggataaacccttcctgaatgcttactcacgcctg
ttgattaaaacctgccataaacgcggtgcttttgcgatgggcggcatggcggcgtttatt
ccaagcaaagatgaagagcgcaataaccaggtgctcgacaaagtaaaagcggataaatcg
ctggaagccaataacggtcacgatggcacatggatcgctcacccgggccttgctgatacg
gcaatggcggtattcaacgatattctcggctcccgcaaaaaccagcttgaggtgatgcgc
gaacaagacgcgccgattactgccgatcagctgctggcaccttgtgatggtgaacgcacc
gaagaaggtatgcgcgccaacattcgcgtggctgtgcagtacatcgaagcgtggatctct
ggcaatggctgtgtgccgatttatggcctgatggaagatgcggcgacggctgaaatttcc
cgtacctcaatctggcagtggatccatcatcaaaaaacgttgagcaatggcaaaccggtg
actaaagccttgttccgccagatgctgggcgaagagatgaaagtcattgccagcgaactg
ggcgaagaacgtttctcccatgggcgttttgacgatgccgcacgcttgatggaacagatc
accacttccgatgagttaattgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system