KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4574Help
Entry
UTI89_C4574       CDS       T00338                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eci01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eci00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4465320..4466639
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPAN
SVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDA
DAADLITSDCDPHDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGI
HSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacacaacaaattgaagaattacagaaagagtgg
actcaaccgcgttgggaaggcattactcgcccgtacagcgcggaagatgtggtgaaatta
cgcggttcagtcaatccggaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgt
ctgctgcacggcgagtcgaaaaaaggctacatcaacagcctcggtgcactgactggtggt
caggcgctgcaacaggcgaaagcgggtattgaagcagtctatctgtcgggatggcaggta
gcggcggacgctaacctggcggccagcatgtatccggatcagtcgctctatccggcaaac
tcggtgccagcggtggtggagcggatcaacaatactttccgccgtgcggatcagatccaa
tggtccgcgggcattgagccgggcgatccgcgctatgtcgattacttcctgccgatcgtc
gccgatgcggaggccggttttggcggtgtactgaatgcctttgaactgatgaaagcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctggcatcagtgaagaaatgt
ggtcacatgggcggcaaagttttggtgccaactcaggaagctattcagaaactggtcgcg
gcgcgtctggcagctgatgtgacgggcgttccaaccctgctggttgctcgtaccgatgcc
gatgcggcggatctgattacctccgattgcgacccacatgacagcgaatttattactggc
gagcgtaccagtgaaggcttcttccgtactcatgcgggtattgagcaagcgatcagccgt
ggcctggcgtatgcgccatatgctgacctggtatggtgtgaaacctccacgccggacctg
gaactggcgcgtcgctttgcacaagccatccacgcgaaatatccgggcaaactgctggct
tataactgctcgccgtcgttcaactggcagaaaaacctcgacgacaaaactattgccagc
ttccagcagcagctgtcggatatgggctacaagttccagttcatcaccctggcaggtatc
cacagcatgtggttcaacatgtttgacctggcaaacgcctatgcccagggcgagggtatg
aagcactatgttgagaaagtgcagcagccggaatttgccgccgcgaaagatggctatacc
ttcgtatctcaccagcaggaagtgggtacaggttacttcgataaagtgacgaccattatt
cagggcggcacgtcgtcggttaccgcactgactggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system