KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4632Help
Entry
UTI89_C4632       CDS       T00338                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UTI89_C4632
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UTI89_C4632
  Amino acid metabolism
   00310 Lysine degradation
    UTI89_C4632
Enzymes [BR:eci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UTI89_C4632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4527393..4528448
Genome map
AA seq 351 aa AA seqDB search
MIAELETDKVILEIPAPHDGVLSNIIVSEGSTVTSAQLLAHLKPQAVIEETVTPVTETLA
MPSARLEAQRSGVELADVAGSGRNGRILKEDVQRVTPAPVIQPERVAEIAPAKPLTPGAR
QERREPMSRLRQRIAERLLASQQNNAILTTFNEVNMQSVMDLRTRWKDRFAEKHGVKLGF
MSFFVKAVTRALERFPVVNASVDGNEIIWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVE
IERQIAEYATQARNGKLPLEALQGGTFSITNGGTFGSMMSTPIINPPQSAILGMHAITPR
PVAENGQVVIRPMMYLALSYDHRIIDGQEAVQTLVAIRELLESPEQLLLDL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgattgccgagctggaaaccgataaagtcattctggaaataccggccccgcacgatggc
gtgttaagcaatattatcgtcagcgaaggtagcacggtcacgtccgcgcaactgttggcg
catcttaagccgcaagctgtcatagaagaaaccgtcacaccagtcaccgaaaccctggcg
atgccttccgcacggctggaggcacagcgtagtggtgtcgaacttgctgacgttgcgggg
agcgggagaaatggacgtatcctgaaagaggatgtacagcgcgttactcctgcaccagtc
attcagcctgaacgggtggcggagatcgcgccagctaaacccttgacaccgggtgctcgt
caggaacgtcgtgagccgatgtcgcgcttacgtcagcgaattgctgagcgtctgctggct
tcccaacaaaataacgccattcttaccacattcaacgaagtaaacatgcagagcgtgatg
gatttacgcacccgctggaaagatcgttttgccgagaagcacggcgtgaagctgggcttt
atgtccttctttgttaaggccgttacccgggcgctggagcgcttccctgtagtgaatgcc
agcgttgatggcaacgagattatctggcgtgattattgcgatatcggcattgcagtgagc
agcaaccgcggcctggtagtgcctgtgttacgcaatgcgcaatcactctctttggtggaa
attgaacggcaaattgccgaatacgccacacaggcacgcaatggcaaattgccgctggag
gcgttacagggcggcacgttctctatcaccaacggcggtacttttggttcgatgatgtca
acgccaatcattaacccgccgcagtcggccattcttgggatgcatgccatcacgccgcgc
ccggtcgcagaaaacggccaggttgttattcgtcccatgatgtaccttgctctcagctat
gaccatcgcattatcgatggtcaggaagccgtgcagacattggtggcaatacgtgagcta
ctggaatcaccggaacaactgttgctggatctttaa

DBGET integrated database retrieval system