KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4865Help
Entry
UTI89_C4865       CDS       T00338                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eci00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eci00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eci03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eci03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eci03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4765443..4765886)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcagttggtgtgtgaaattgccgcagaacgttggcgcagtggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccgactggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaagcgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system