KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C5112Help
Entry
UTI89_C5112       CDS       T00338                                 

Gene name
ybcS2
Definition
bacteriophage lambda lysozyme-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5005389..5005886
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGDDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWIYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagcagttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtgacgatggcctggaaggtgtcagctacata
ccatacaaagatatcgttggcgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggttgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtctacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgaccagctacgtcgctggatatac
gctggcggtaagcaatggaaaggcctgatgactcgtcgtgagattgagcgtgaagtctgt
ttgtgggggcaacaatga

DBGET integrated database retrieval system