KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C5153Help
Entry
UTI89_C5153       CDS       T00338                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase (EC:2.4.2.4)
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    UTI89_C5153 (deoA)
Enzymes [BR:eci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     UTI89_C5153 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5041854..5043245
Genome map
AA seq 463 aa AA seqDB search
MPDDAAMLIRFPDYLVSFPREVTLFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEG
QIAALAMTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLM
LGPMVAACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQT
SSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELS
EALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTM
ALCVEMLISGKLAKNDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTA
MLTKAVYADTEGFVSEMDTRALGMTVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQR
PLAVIHAKDENSWQEAAKAVKAAIKLADKAPESTPTVYRRISE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttgccggatgatgcagcgatgctcatccggttccccgattacctcgtctcttttccacgg
gaggttaccttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctg
agtgatgaagaaattcgtttctttatcaacggcattcgcgacaacactatctccgaaggg
cagattgccgccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtc
tcgctgaccatggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctg
aatggcccgattgttgataaacactcgaccggcggtgtcggcgatgtgacttcgctgatg
ttggggccgatggtcgctgcctgtggcggctatattccgatgatctccggtcgcggcctc
ggtcatactggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccg
gatgacaaccgtttccgcgaaattattaaagacgtcggcgtggcgattatcggccagacc
agctcactggctccggcggataaacgtttctacgcgacccgcgatattaccgcaaccgtg
gattcaatcccgctgatcaccgcctctattctggcgaagaaactggcggaaggtctggac
gcgctggtgatggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctct
gaagcccttgccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcg
ctgctcaccgatatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgt
gaagcggtgcagttcctgacgggtgaatatcgtaacccgcgtctgtttgatgtcacgatg
gcactgtgcgtggagatgctgatctccggcaaactggcgaaaaatgacgccgaagcgcgc
gcgaaattgcaggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtc
gcggcacaaaaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcg
atgctgacgaaagcagtctatgctgataccgaagggtttgtcagtgaaatggatacccgc
gcactggggatgacagtggttgcaatgggcggcggacgccgtcaggcatctgacaccatc
gattacagcgtcggctttactgatatggcgcgtctgggcgaccaggtagacggtcagcgt
ccgctggcagttatccacgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtg
aaagcggcaattaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgt
atcagcgaataa

DBGET integrated database retrieval system