KEGG   Escherichia coli K-12 W3110: JW0001Help
Entry
JW0001            CDS       T00068                                 

Gene name
thrA
Definition
(GenBank) fused aspartokinase I and homoserine dehydrogenase I
  KO
K12524  
bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JW0001 (thrA)
   00270 Cysteine and methionine metabolism
    JW0001 (thrA)
   00300 Lysine biosynthesis
    JW0001 (thrA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    JW0001 (thrA)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     JW0001 (thrA)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     JW0001 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
337..2799
Genome map
AA seq 820 aa AA seqDB search
MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITNHLVAMIEKTISGQDA
LPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHVLHGISLLGQCPDSINA
ALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLESTVDIAESTRRIAASRIP
ADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYTCDPRQV
PDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCLIKNTGNPQAPGTLIGASRD
EDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMSRARISVVLITQSSSEYSISF
CVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAIISVVGDGMRTLRGISAKFFAAL
ARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQMLFNTDQVIEVFVIGVGGVGGAL
LEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLNLENWQEELAQAKEPFNLGRLIRL
VKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVTPNKKANTSSMDYYHQLRYAAEKSR
RKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGILSGSLSYIFGKLDEGMSFSEATTLA
REMGYTEPDPRDDLSGMDVARKLLILARETGRELELADIEIEPVLPAEFNAEGDVAAFMA
NLSQLDDLFAARVAKARDEGKVLRYVGNIDEDGVCRVKIAEVDGNDPLFKVKNGENALAF
YSHYYQPLPLVLRGYGAGNDVTAAGVFADLLRTLSWKLGV
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgttgaagttcggcggtacatcagtggcaaatgcagaacgttttctgcgtgtt
gccgatattctggaaagcaatgccaggcaggggcaggtggccaccgtcctctctgccccc
gccaaaatcaccaaccacctggtggcgatgattgaaaaaaccattagcggccaggatgct
ttacccaatatcagcgatgccgaacgtatttttgccgaacttttgacgggactcgccgcc
gcccagccggggttcccgctggcgcaattgaaaactttcgtcgatcaggaatttgcccaa
ataaaacatgtcctgcatggcattagtttgttggggcagtgcccggatagcatcaacgct
gcgctgatttgccgtggcgagaaaatgtcgatcgccattatggccggcgtattagaagcg
cgcggtcacaacgttactgttatcgatccggtcgaaaaactgctggcagtggggcattac
ctcgaatctaccgtcgatattgctgagtccacccgccgtattgcggcaagccgcattccg
gctgatcacatggtgctgatggcaggtttcaccgccggtaatgaaaaaggcgaactggtg
gtgcttggacgcaacggttccgactactctgctgcggtgctggctgcctgtttacgcgcc
gattgttgcgagatttggacggacgttgacggggtctatacctgcgacccgcgtcaggtg
cccgatgcgaggttgttgaagtcgatgtcctaccaggaagcgatggagctttcctacttc
ggcgctaaagttcttcacccccgcaccattacccccatcgcccagttccagatcccttgc
ctgattaaaaataccggaaatcctcaagcaccaggtacgctcattggtgccagccgtgat
gaagacgaattaccggtcaagggcatttccaatctgaataacatggcaatgttcagcgtt
tctggtccggggatgaaagggatggtcggcatggcggcgcgcgtctttgcagcgatgtca
cgcgcccgtatttccgtggtgctgattacgcaatcatcttccgaatacagcatcagtttc
tgcgttccacaaagcgactgtgtgcgagctgaacgggcaatgcaggaagagttctacctg
gaactgaaagaaggcttactggagccgctggcagtgacggaacggctggccattatctcg
gtggtaggtgatggtatgcgcaccttgcgtgggatctcggcgaaattctttgccgcactg
gcccgcgccaatatcaacattgtcgccattgctcagggatcttctgaacgctcaatctct
gtcgtggtaaataacgatgatgcgaccactggcgtgcgcgttactcatcagatgctgttc
aataccgatcaggttatcgaagtgtttgtgattggcgtcggtggcgttggcggtgcgctg
ctggagcaactgaagcgtcagcaaagctggctgaagaataaacatatcgacttacgtgtc
tgcggtgttgccaactcgaaggctctgctcaccaatgtacatggccttaatctggaaaac
tggcaggaagaactggcgcaagccaaagagccgtttaatctcgggcgcttaattcgcctc
gtgaaagaatatcatctgctgaacccggtcattgttgactgcacttccagccaggcagtg
gcggatcaatatgccgacttcctgcgcgaaggtttccacgttgtcacgccgaacaaaaag
gccaacacctcgtcgatggattactaccatcagttgcgttatgcggcggaaaaatcgcgg
cgtaaattcctctatgacaccaacgttggggctggattaccggttattgagaacctgcaa
aatctgctcaatgcaggtgatgaattgatgaagttctccggcattctttctggttcgctt
tcttatatcttcggcaagttagacgaaggcatgagtttctccgaggcgaccacgctggcg
cgggaaatgggttataccgaaccggacccgcgagatgatctttctggtatggatgtggcg
cgtaaactattgattctcgctcgtgaaacgggacgtgaactggagctggcggatattgaa
attgaacctgtgctgcccgcagagtttaacgccgagggtgatgttgccgcttttatggcg
aatctgtcacaactcgacgatctctttgccgcgcgcgtggcgaaggcccgtgatgaagga
aaagttttgcgctatgttggcaatattgatgaagatggcgtctgccgcgtgaagattgcc
gaagtggatggtaatgatccgctgttcaaagtgaaaaatggcgaaaacgccctggccttc
tatagccactattatcagccgctgccgttggtactgcgcggatatggtgcgggcaatgac
gttacagctgccggtgtctttgctgatctgctacgtaccctctcatggaagttaggagtc
tga

DBGET integrated database retrieval system