KEGG   Escherichia coli K-12 W3110: JW0113Help
Entry
JW0113            CDS       T00068                                 

Gene name
yacH
Definition
(GenBank) hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(129407..131260)
Genome map
AA seq 617 aa AA seqDB search
MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQLAVSDAAAVTFPATVS
APPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPTNVAQAVQWSHDNPLKQ
GDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDSVQRLRQ
LAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLTANPVITEPATTVISIEPA
NPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSFVRGFGYSMGVATTYALFSS
IDWDDDDHDHHHHDNDDYHHHDGGHRDGNGWQHNGDNINIDVNNFNRITGEHLTDKNMAW
RHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPTRDSQRQAAANQFQQRTHAAPV
ITRDTQRQAAAQRFNEAEHYGSYDDFHDFSRRQPLTQQQKDAARQRYQSASPEQRQAVRE
RMQTNPKIQQRREAARERIQSASPEQRQAVREKMQTNPQNQQRRDAARERIQSASPEQRQ
VFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFREKVQESRPQRLNDSNHTVRLNNEQR
SAVCERLSERGARRLER
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgactttgccgtttaaaccccatgtgctggcgctaatttgcagtgccgggctt
tgtgccgcctctaccgggctatatataaaaagccgcacagtggaagcgcctgtggaaccg
caatcgacacaactggctgtgtctgacgctgccgcggttacgtttcctgcaacggtttcc
gcacctcccgtaacacccgccgtcgtcaaatccgcattcagcactgcacaaatagatcaa
tgggtcgcgcccgtcgcgctgtatcccgacgccctactttcgcaggtgctgatggcatca
acctatccgacaaacgttgctcaagcagtgcaatggtcgcacgataatccacttaaacaa
ggcgatgctgctattcaggcggtatctgaccagccgtgggacgccagcgttaaatcactg
gtggcctttccacaattgatggcattgatgggcgaaaacccgcaatgggtgcaaaacctg
ggcgatgcttttctggcccagccgcaggacgtgatggactcggtacagcgattgcggcaa
ctggcgcaacaaaccggctcgctgaagtcatcaaccgaacagaaagttattaccacaacg
aagaaagctgtaccggtaaaacagacagtcacggcacccgtcataccatccaatacagtt
ttaactgccaaccccgtcattacagagccggcaacaaccgtcatttccattgagcccgcc
aatcctgatgtggtctatattcccaactacaacccaaccgtggtttacgggaactgggcc
aatactgcgtatccgccggtttatctgccaccaccagccggagaaccgtttgttgacagc
tttgtacgcggattcggctatagcatgggcgttgctaccacgtacgcactattcagcagc
atcgactgggacgacgacgatcatgaccatcatcatcatgacaatgatgattatcatcac
cacgatggcggtcatcgtgacggtaatggctggcaacacaacggcgacaacatcaatatc
gacgtcaacaatttcaaccgtatcaccggtgagcatcttactgataagaatatggcatgg
cggcacaatccaaactaccgtaatggtgtgccctatcatgatcaggatatggcaaagcgg
tttcatcaaaccgatgtcaacggcggaatgagcgccacgcaattacctgccccaacgcgc
gacagccagcgtcaggcggcagcaaatcagtttcagcaacgaacacacgccgcaccagtc
attacacgagatacccaacgtcaggcagcggcacagcggtttaatgaagctgaacactat
gggagctatgacgacttccacgacttcagccgtcgccaaccactgacccagcaacaaaag
gacgccgctcgtcagcgttatcagtccgcctcgcctgagcagcgccaggcagttcgcgag
agaatgcagactaacccgaagatccagcagcgaagagaggcagcgcgtgagcgcattcag
tccgcctcgcctgagcagcgccaggcggttcgcgagaaaatgcagactaacccgcagaac
cagcagcgaagagacgcagcgcgtgagcgtattcagtccgcatcaccagagcagcgccag
gtgtttaaggaaaaagtacagcagcgcccactgaatcaacagcaacgtgataacgcccgc
cagcgtgttcaatcggcatcacctgaacaacgtcaggtttttcgggagaaagttcaggag
agccgcccacaacgtctaaacgacagtaaccatactgtcaggctgaataacgagcaacgg
tcagcagtatgcgaacgtctctctgaacgtggagcaagaagactggaaaggtaa

DBGET integrated database retrieval system