KEGG   Escherichia coli K-12 W3110: JW0680Help
Entry
JW0680            CDS       T00068                                 

Gene name
speF
Definition
(GenBank) ornithine decarboxylase isozyme, inducible
  KO
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    JW0680 (speF)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    JW0680 (speF)
Enzymes [BR:ecj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     JW0680 (speF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(718684..720882)
Genome map
AA seq 732 aa AA seqDB search
MSKLKIAVSDSCPDCFTTQRECIYINESRNIDVAAIVLSLNDVTCGKLDEIDATGYGIPV
FIATENQERVPAEYLPRISGVFENCESRREFYGRQLETAASHYETQLRPPFFRALVDYVN
QGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEALFRADLCNADVAMGDLLIHEGAPCIAQ
QHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVLFDRNNHKSNHHGALLQAGATPV
YLETARNPYGFIGGIDAHCFEESYLRELIAEVAPQRAKEARPFRLAVIQLGTYDGTIYNA
RQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLLLDLNENDPGILVTQSVHKQQAGF
SQTSQIHKKDSHIKGQQRYVPHKRMNNAFMMHASTSPFYPLFAALNINAKMHEGVSGRNM
WMDCVVNGINARKLILDNCQHIRPFVPELVDGKPWQSYETAQIAVDLRFFQFVPGEHWHS
FEGYAENQYFVDPCKLLLTTPGIDARNGEYEAFGVPATILANFLRENGVVPEKCDLNSIL
FLLTPAEDMAKLQQLVALLVRFEKLLESDAPLAEVLPSIYKQHEERYAGYTLRQLCQEMH
DLYARHNVKQLQKEMFRKEHFPRVSMNPQEANYAYLRGEVELVRLPDAEGRIAAEGALPY
PPGVLCVVPGEIWGGAVLRYFSALEEGINLLPGFAPELQGVYIEEHDGRKQVWCYVIKPR
DAQSTLLKGEKL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattaaaaattgcggttagtgattcttgcccggactgttttaccacgcagcga
gaatgtatctacattaatgaaagtcgtaatatcgatgtggcggcaatagttttatcgctc
aacgatgttacatgcggaaaactcgatgaaatcgatgccacgggttatggcatcccggta
tttattgctactgaaaatcaagaacgtgtacccgcagagtatttgccccgtatttcgggt
gtctttgagaattgcgaatcgcgacgagaattttatggtcgccagttagaaaccgctgcc
agccattatgaaactcaactgcgcccacctttcttccgcgcactggtcgattatgtcaat
caaggtaacagcgcgtttgattgccctggtcatcagggcggcgaatttttccgtcgccat
ccggcggggaatcagtttgtggaatactttggtgaggcgctgttccgtgccgacttgtgc
aacgccgacgtagcgatgggcgatctgctgattcacgaaggcgcgccatgcattgcacag
caacatgcggcaaaagtgtttaatgccgataaaacctacttcgttttaaatggcacttca
tcttctaacaaagtggttttaaacgccctgctaacaccgggtgatctggtgctgtttgat
cgcaataaccacaaatctaaccaccacggagcgttgctacaggctggtgcaacaccggtt
tatctggaaacggcacgtaacccgtatggctttatcggtggcattgatgcgcactgtttt
gaagaaagttacctgcgtgagctgatcgcggaagtcgcaccgcagcgggcaaaagaggct
cgtcctttccgcctcgctgtgattcagttaggcacctacgacggtacgatttataacgcc
cgccaagtggtggataaaattggtcatctgtgtgactacatcctgtttgactcagcatgg
gtcggctatgaacagtttattccgatgatggcggactgttcgccgctgttgctggatctt
aatgagaacgatccgggtattctggttacgcaatctgtgcataaacaacaggctggtttt
tctcagacttcacaaattcataaaaaagacagccacatcaaagggcaacagcgttatgta
ccgcacaaacgcatgaacaacgcctttatgatgcacgcctccaccagcccgttctatccg
ctgtttgccgcactgaatatcaacgccaaaatgcatgaaggtgtcagcggtcgtaatatg
tggatggattgtgtggtaaatggcattaatgcccgcaaactgatcctcgataactgtcag
catattcgtccgttcgtacctgaactggtggatggtaaaccctggcagtcgtatgaaaca
gcgcaaattgcggttgatctgcgcttcttccagtttgtaccaggggaacactggcattct
tttgaaggctatgcagagaatcaatactttgtcgatccatgcaaactgttgctgacaacc
ccaggtattgatgcacgtaacggcgaatatgaagcgttcggtgtacccgcgacgattctt
gctaacttcctgcgcgaaaatggcgtagtgccggaaaaatgcgatcttaactccatcctc
ttcctgctgactccggcagaagatatggccaaacttcagcaacttgttgccctgctggta
cgcttcgaaaaactgcttgagtccgacgcgccattagcagaagtgctaccttccatctac
aaacagcatgaagagcgctacgccggttataccctgcgtcagttgtgtcaggaaatgcat
gatttgtatgcccgccacaacgtgaaacaactgcaaaaagagatgttccgtaaggagcac
ttcccacgcgtcagcatgaatccgcaagaagccaactacgcctatttacgcggtgaagtg
gaactggttcgtctgccggatgcagaaggccgtatcgctgccgaaggtgcgcttccttat
cctccgggtgtgctgtgtgttgttccgggtgaaatctggggtggtgctgttctgcgttac
ttcagcgctctggaagaagggatcaacctgctgccaggttttgcaccggagctgcagggt
gtctatatcgaagaacatgatggtcgtaagcaagtttggtgctatgtcatcaagcctcgt
gatgcgcaaagcaccctgttgaaaggggaaaaattatga

DBGET integrated database retrieval system