KEGG   Escherichia coli K-12 W3110: JW0802Help
Entry
JW0802            CDS       T00068                                 

Gene name
ybiR
Definition
(GenBank) predicted transporter
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
854069..855187
Genome map
AA seq 372 aa AA seqDB search
MSLPFLRTLQGDRFFQLLILVGIGLSFFVPFAPKSWPAAIDWHTIITLSGLMLLTKGVEL
SGYFDVLGRKMVRRFATERRLAMFMVLAAALLSTFLTNDVALFIVVPLTITLKRLCEIPV
NRLIIFEALAVNAGSLLTPIGNPQNILIWGRSGLSFAGFIAQMAPLAGAMMLTLLLLCWC
CFPGKAMQYHTGVQTPEWKPRLVWSCLGLYIVFLTALEFKQELWGLVIVAAGFALLARRV
VLSVDWTLLLVFMAMFIDVHLLTQLPALQGVLGNVSHLSEPGLWLTAIGLSQVISNVPST
ILLLNYVPPSLLLVWAVNVGGFGLLPGSLANLIALRMANDRRIWWRFHLYSIPMLLWAAL
VGYVLLVILPAN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgccttttttacgcacgctgcaaggcgatcgtttttttcagttattaattctt
gttggtatcggattaagctttttcgtgccctttgcaccgaaatcctggcctgctgctatc
gactggcacaccatcatcaccttaagcggcctgatgctgctgaccaaaggtgtggagtta
agcggttattttgatgtgctggggcgcaaaatggtgcgccgctttgctacggagcgtcgg
ctggcgatgtttatggtgctggcggcggcgctgctttctacctttctgaccaacgatgtc
gcgctgtttattgttgttccgctgactatcacgctaaaaagactgtgtgagatcccggtt
aatcggctgattatttttgaggcgctggcagtcaacgctggttcgctactgacgccaatt
ggcaacccgcaaaatattcttatctggggacgttctggtctttcgtttgccggatttatt
gcccaaatggcaccgctggctggcgcaatgatgctgacgctcctgctcctgtgctggtgt
tgtttccctggaaaggcgatgcaataccatacgggggtgcaaacaccggagtggaaaccg
cggctggtgtggagttgtctggggctgtatatcgtctttctgacggcgctggagttcaaa
caagagctgtggggactggtgattgtggcggcaggctttgcgctgctggcacgtcgcgtg
gtgctcagtgtggactggacgctgctgctggtgtttatggcgatgtttatcgacgtccat
ttactgacccagcttccagcgttgcaaggcgtgttgggtaacgtgagtcatctatctgaa
cccgggttatggttaacggcaatcggtttatcgcaggtgatcagtaacgtgccgagtacc
atattgttgctgaactatgtgccgccgtctttattactggtatgggcggtaaacgtaggt
ggctttgggttattacccggatcgctggcaaatttgattgcgctacgtatggcgaacgat
cgccgcatctggtggcgtttccatctctattcaataccgatgctgttgtgggcggcgttg
gtgggatatgttttgttagttatactcccggccaactag

DBGET integrated database retrieval system