KEGG   Escherichia coli K-12 W3110: JW0912Help
Entry
JW0912            CDS       T00068                                 

Gene name
ompF
Definition
(GenBank) outer membrane porin 1a (Ia;b;F)
  KO
K09476  
outer membrane pore protein F
Organism
ecj  Escherichia coli K-12 W3110
Pathway
beta-Lactam resistance
Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    JW0912 (ompF)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    JW0912 (ompF)
Transporters [BR:ecj02000]
 Other Transporters
  Pores ion channels [TC:1]
   JW0912 (ompF)
Antimicrobial resistance genes [BR:ecj01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    JW0912 (ompF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(986316..987404)
Genome map
AA seq 362 aa AA seqDB search
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM
TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY
GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL
GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKS
KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY
QF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcgcaatattctggcagtgatcgtccctgctctgttagtagcaggtactgca
aacgctgcagaaatctataacaaagatggcaacaaagtagatctgtacggtaaagctgtt
ggtctgcattatttttccaagggtaacggtgaaaacagttacggtggcaatggcgacatg
acctatgcccgtcttggttttaaaggggaaactcaaatcaattccgatctgaccggttat
ggtcagtgggaatataacttccagggtaacaactctgaaggcgctgacgctcaaactggt
aacaaaacgcgtctggcattcgcgggtcttaaatacgctgacgttggttctttcgattac
ggccgtaactacggtgtggtttatgatgcactgggttacaccgatatgctgccagaattt
ggtggtgatactgcatacagcgatgacttcttcgttggtcgtgttggcggcgttgctacc
tatcgtaactccaacttctttggtctggttgatggcctgaacttcgctgttcagtacctg
ggtaaaaacgagcgtgacactgcacgccgttctaacggcgacggtgttggcggttctatc
agctacgaatacgaaggctttggtatcgttggtgcttatggtgcagctgaccgtaccaac
ctgcaagaagctcaacctcttggcaacggtaaaaaagctgaacagtgggctactggtctg
aagtacgacgcgaacaacatctacctggcagcgaactacggtgaaacccgtaacgctacg
ccgatcactaataaatttacaaacaccagcggcttcgccaacaaaacgcaagacgttctg
ttagttgcgcaataccagttcgatttcggtctgcgtccgtccatcgcttacaccaaatct
aaagcgaaagacgtagaaggtatcggtgatgttgatctggtgaactactttgaagtgggc
gcaacctactacttcaacaaaaacatgtccacctatgttgactacatcatcaaccagatc
gattctgacaacaaactgggcgtaggttcagacgacaccgttgctgtgggtatcgtttac
cagttctaa

DBGET integrated database retrieval system