KEGG   Escherichia coli K-12 W3110: JW1322Help
Entry
JW1322            CDS       T00068                                 

Gene name
mppA
Definition
(GenBank) murein tripeptide (L-ala-gamma-D-glutamyl-meso-DAP) transporter subunit
  KO
K15580  
oligopeptide transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
beta-Lactam resistance
ABC transporters
Quorum sensing
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    JW1322 (mppA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    JW1322 (mppA)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    JW1322 (mppA)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    JW1322 (mppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1394941..1396554
Genome map
AA seq 537 aa AA seqDB search
MKHSVSVTCCALLVSSISLSYAAEVPSGTVLAEKQELVRHIKDEPASLDPAKAVGLPEIQ
VIRDLFEGLVNQNEKGEIVPGVATQWKSNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQ
RLVDPKTLSPFAWFAALAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNL
TANFAFFPVQKANVESGKEWTKPGNLIGNGAYVLKERVVNEKLVVVPNTHYWDNAKTVLQ
KVTFLPINQESAATKRYLAGDIDITESFPKNMYQKLLKDIPGQVYTPPQLGTYYYAFNTQ
KGPTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTAGFTPEPSPFEQMSQEEL
NAQAKTLLSAAGYGPQKPLKLTLLYNTSENHQKIAIAVASMWKKNLGVDVKLQNQEWKTY
IDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVK
ARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKGYPINNPEDVAYSRTMYIVKH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagcactctgtttcagtcacgtgttgtgcgctgttggtcagcagcatttctctttcg
tatgctgcagaagttccgagcggcacagtactggcagagaagcaggagctggtgcgccac
attaaagatgagcctgcgtcgctggatcccgctaaagccgtgggcctgccagagattcag
gtcattcgcgatctgtttgaaggtctggtgaatcagaacgaaaaaggggagattgtcccc
ggcgttgcgactcagtggaaaagtaatgacaaccgtatctggacttttaccctgcgcgat
aacgcaaaatgggcggatggcacaccggtaacggcgcaagattttgtctacagctggcaa
cgtctggtggacccaaaaacattgtcgccatttgcatggtttgccgcgctggcgggaatc
aacaacgcacaggcgattattgatggtaaagctacgcctgaccagcttggcgtcaccgca
gttgatgcccatactttgaaaattcagcttgataaaccgttgccgtggtttgtgaattta
accgctaactttgccttcttcccggtgcaaaaagccaacgtagaaagcggtaaagagtgg
acgaaacccggaaatctgatcggcaatggcgcttatgttcttaaagagcgcgtagtcaat
gaaaaactggtcgtggtaccgaatacccattattgggataacgccaaaacggtactgcaa
aaagtgaccttcctgccaattaatcaggaatccgcagccactaagcgttacctcgcgggg
gatattgatatcaccgaatccttcccgaaaaatatgtatcagaagctgttgaaggatatt
ccggggcaggtttatacgccgccgcagctcgggacctattattatgcgtttaacacgcaa
aaagggccgacggcagatcagcgcgttcgtctggcattaagtatgacgatagatcgccgc
ctgatgaccgaaaaagtattagggacgggcgaaaagccagcgtggcattttacaccagat
gttaccgcgggatttacgccggaaccttcgccgtttgaacaaatgagtcaggaagaactg
aatgcgcaggcaaaaactttgttgagcgcagctggttatggtccgcaaaaaccgctgaag
ctgacgcttttgtataacacttcagaaaaccatcaaaaaattgcgattgctgtagcatcg
atgtggaaaaagaaccttggcgtagatgttaaattgcaaaatcaggaatggaaaacctat
atcgatagccgtaacaccggcaattttgatgttatccgcgcctcgtgggtgggggattat
aatgaaccctccactttcctgacattattaacgtcaacgcattcaggaaatatttcacgc
tttaacaatccggcatatgacaaagttctggcccaggcatcgacggaaaataccgttaaa
gcgcgtaatgccgattacaacgcggcagaaaaaatcctcatggagcaagcaccgattgca
ccaatttatcaatataccaatggacgattaatcaagccgtggctgaaaggttatcccatt
aataatcctgaagatgtggcgtacagtcggactatgtatattgtgaagcattga

DBGET integrated database retrieval system