KEGG   Escherichia coli K-12 W3110: JW1337Help
Entry
JW1337            CDS       T00068                                 

Gene name
dbpA
Definition
(GenBank) ATP-dependent RNA helicase specific for 23S rRNA
  KO
K05591  
ATP-independent RNA helicase DbpA [EC:3.6.4.13]
Organism
ecj  Escherichia coli K-12 W3110
Brite
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     JW1337 (dbpA)
Ribosome biogenesis [BR:ecj03009]
 Prokaryotic Type
  rRNA helicases
   JW1337 (dbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1411225..1412598
Genome map
AA seq 457 aa AA seqDB search
MTAFSTLNVLPPAQLTNLNELGYLTMTPVQAAALPAILAGKDVRVQAKTGSGKTAAFGLG
LLQQIDASLFQTQALVLCPTRELADQVAGELRRLARFLPNTKILTLCGGQPFGMQRDSLQ
HAPHIIVATPGRLLDHLQKGTVSLDALNTLVMDEADRMLDMGFSDAIDDVIRFAPASRQT
LLFSATWPEAIAAISGRVQRDPLAIEIDSTDALPPIEQQFYETSSKGKIPLLQRLLSLHQ
PSSCVVFCNTKKDCQAVCDALNEVGQSALSLHGDLEQRDRDQTLVRFANGSARVLVATDV
AARGLDIKSLELVVNFELAWDPEVHVHRIGRTARAGNSGLAISFCAPEEAQRANIISDML
QIKLNWQTPPANSSIATLEAEMATLCIDGGKKAKMRPGDVLGALTGDIGLDGADIGKIAV
HPAHVYVAVRQAVAHKAWKQLQGGKIKGKTCRVRLLK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctttttctaccctgaatgttttgcctcccgcccaactcacgaaccttaatgag
ttgggttatttaaccatgacgccggtgcaggccgccgcgcttccggcgatccttgccgga
aaagatgttcgcgtgcaggcgaaaaccggcagcggcaaaacggcggcttttggcctcggc
ttgttacagcaaattgatgcgtcgctatttcaaacccaggctttagtgctgtgtcctacg
cgtgaactggcggatcaggtggcaggtgaattgcgtcggctggcgcgttttctgccaaat
accaaaattttgacgttgtgcggtggtcaaccgttcggtatgcagcgtgattcgttgcaa
catgcgccgcatattatcgtggcaacgccggggcgtttgctggatcacctgcaaaaaggc
acggtatcactggatgcgttgaatacgctggtgatggatgaggccgaccgcatgctggat
atgggatttagcgatgccattgatgatgtcatccgttttgcgcctgcatctcgacagacg
cttctgttttcggcaacctggccggaagccatcgctgcaatcagcggacgagtgcaacgc
gatcctttggcgattgaaattgactcaacagatgctttgccacccattgaacaacaattt
tatgagacatccagcaaaggcaaaattcctctgttgcaacggttattaagcttgcatcag
ccatcctcttgcgtggtgttttgcaataccaaaaaagattgccaggctgtctgcgacgcg
ctgaatgaagtagggcaaagtgcattgtcattacacggcgatttggagcaacgcgatcgc
gatcagaccctggtacgttttgctaacggtagcgcccgtgtactggtcgcgactgatgtt
gctgcgcgtggtctggatattaaatcgcttgagctggtggtgaactttgagctggcgtgg
gaccctgaagttcatgtacatcgcatcggtcgtacagctcgtgcaggaaatagcggtctg
gcgatcagtttctgtgctccggaagaagcacagcgggccaatatcatttctgacatgttg
cagataaaacttaactggcaaacgccgccagctaatagttccattgcgacgctggaagca
gaaatggcaacgttgtgtatcgatggcgggaaaaaagccaaaatgcgcccgggtgatgta
ttaggtgcactgacaggagatatcgggcttgatggcgcagatattggcaaaatcgccgtg
catccggcgcatgtctatgtcgcggtccgtcaggctgttgctcataaagcatggaaacag
ttacagggcgggaagattaaaggaaaaacgtgccgggtgcggttattaaaataa

DBGET integrated database retrieval system