KEGG   Escherichia coli K-12 W3110: JW1553Help
Entry
JW1553            CDS       T00068                                 

Gene name
rem
Definition
(GenBank) hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1646365..1646616)
Genome map
AA seq 83 aa AA seqDB search
MMNIEELRKIFCEDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGE
FVTSLQALKEIGIKAGFSAFSGE
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacatcgaagaactgcgtaaaattttttgtgaagatggcctctatgctgtgtgc
gttgaaaatggaaatcttgttagtcattaccgcattatgtgtttgcgaaagaatggggct
gcgttaattaattttgtggatgctcgggtcacggacggatttatcttgcgcgaaggtgag
tttgtcacttcattacaggcattgaaagagatcggaataaaagctggcttttctgctttt
tcaggagaataa

DBGET integrated database retrieval system