KEGG   Escherichia coli K-12 W3110: JW1666Help
Entry
JW1666            CDS       T00068                                 

Gene name
pykF
Definition
(GenBank) pyruvate kinase I
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JW1666 (pykF)
   01230 Biosynthesis of amino acids
    JW1666 (pykF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JW1666 (pykF)
   00620 Pyruvate metabolism
    JW1666 (pykF)
  Nucleotide metabolism
   00230 Purine metabolism
    JW1666 (pykF)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     JW1666 (pykF)
Exosome [BR:ecj04147]
 Exosomal proteins
  Proteins found in most exosomes
   JW1666 (pykF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1757412..1758824
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKT
AAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVG
NTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIF
GCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSRLEFNNDNRKLRITEAVCR
GAVETAEKLDAPLIVVATQGGKSARAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLV
KEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccaaaattgtttgcaccatcggaccgaaaaccgaatctgaagagatgtta
gctaaaatgctggacgctggcatgaacgttatgcgtctgaacttctctcatggtgactat
gcagaacacggtcagcgcattcagaatctgcgcaacgtgatgagcaaaactggtaaaacc
gccgctatcctgcttgataccaaaggtccggaaatccgcaccatgaaactggaaggcggt
aacgacgtttctctgaaagctggtcagacctttactttcaccactgataaatctgttatc
ggcaacagcgaaatggttgcggtaacgtatgaaggtttcactactgacctgtctgttggc
aacaccgtactggttgacgatggtctgatcggtatggaagttaccgccattgaaggtaac
aaagttatctgtaaagtgctgaacaacggtgacctgggcgaaaacaaaggtgtgaacctg
cctggcgtttccattgctctgccagcactggctgaaaaagacaaacaggacctgatcttt
ggttgcgaacaaggcgtagactttgttgctgcttcctttattcgtaagcgttctgacgtt
atcgaaatccgtgagcacctgaaagcgcacggcggcgaaaacatccacatcatctccaaa
atcgaaaaccaggaaggcctcaacaacttcgacgaaatcctcgaagcctctgacggcatc
atggttgcgcgtggcgacctgggtgtagaaatcccggtagaagaagttatcttcgcccag
aagatgatgatcgaaaaatgtatccgtgcacgtaaagtcgttatcactgcgacccagatg
ctggattccatgatcaaaaacccacgcccgactcgcgcagaagccggtgacgttgcaaac
gccatcctcgacggtactgacgcagtgatgctgtctggtgaatccgcaaaaggtaaatac
ccgctggaagcggtttctatcatggcgaccatctgcgaacgtaccgaccgcgtgatgaac
agccgtctcgagttcaacaatgacaaccgtaaactgcgcattaccgaagcggtatgccgt
ggtgccgttgaaactgctgaaaaactggatgctccgctgatcgtggttgctactcagggc
ggtaaatctgctcgcgcagtacgtaaatacttcccggatgccaccatcctggcactgacc
accaacgaaaaaacggctcatcagttggtactgagcaaaggcgttgtgccgcagcttgtt
aaagagatcacttctactgatgatttctaccgtctgggtaaagaactggctctgcagagc
ggtctggcacacaaaggtgacgttgtagttatggtttctggtgcactggtaccgagcggc
actactaacaccgcatctgttcacgtcctgtaa

DBGET integrated database retrieval system