KEGG   Escherichia coli K-12 W3110: JW1726Help
Entry
JW1726            CDS       T00068                                 

Gene name
chbC
Definition
(GenBank) N,N'-diacetylchitobiose-specific enzyme IIC component of PTS
  KO
K02761  
PTS system, cellobiose-specific IIC component
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Starch and sucrose metabolism
Phosphotransferase system (PTS)
Module
PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    JW1726 (chbC)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    JW1726 (chbC)
Transporters [BR:ecj02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    JW1726 (chbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1821570..1822928)
Genome map
AA seq 452 aa AA seqDB search
MSNVIASLEKVLLPFAVKIGKQPHVNAIKNGFIRLMPLTLAGAMFVLINNVFLSFGEGSF
FYSLGIRLDASTIETLNGLKGIGGNVYNGTLGIMSLMAPFFIGMALAEERKVDALAAGLL
SVAAFMTVTPYSVGEAYAVGANWLGGANIISGIIIGLVVAEMFTFIVRRNWVIKLPDSVP
ASVSRSFSALIPGFIILSVMGIIAWALNTWGTNFHQIIMDTISTPLASLGSVVGWAYVIF
VPLLWFFGIHGALALTALDNGIMTPWALENIATYQQYGSVEAALAAGKTFHIWAKPMLDS
FIFLGGSGATLGLILAIFIASRRADYRQVAKLALPSGIFQINEPILFGLPIIMNPVMFIP
FVLVQPILAAITLAAYYMGIIPPVTNIAPWTMPTGLGAFFNTNGSVAALLVALFNLGIAT
LIYLPFVVVANKAQNAIDKEESEEDIANALKF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgttattgcatcgcttgaaaaggtactcctcccttttgcagttaaaatagga
aagcagccacacgttaatgcaatcaaaaatggctttattcgcttaatgccgttaaccctt
gcgggggccatgtttgtattaattaacaacgtttttctaagctttggggaggggtcgttt
ttttattccttaggtattcgcctcgacgcctcaaccattgaaacacttaatggtctgaaa
ggtattggcggcaacgtatataacggaacattaggaataatgtctttaatggcaccgttc
tttattggcatggcgctggcagaagagcgtaaagtcgatgcgctggcggctgggttgtta
tccgttgcagcatttatgaccgtcaccccatatagtgtcggtgaggcctatgcggttggt
gcaaactggttaggtggggcgaatatcatctccgggattattattggcctggtggtggca
gaaatgtttacctttattgtccgccgcaattgggtcattaaactgcccgacagcgtacct
gcttcagtatcgcgttccttctcggcattaattcccggctttattattctttccgtgatg
gggattattgcctgggcgttgaatacctggggcaccaacttccatcagatcattatggat
accatctcaaccccactggcatcgttgggtagcgtggtgggctgggcctatgtgatcttt
gttccactgctctggttcttcggtattcatggcgcgctggcgctgaccgcactggacaac
ggcattatgacgccgtgggcactggaaaatatcgcgacctatcagcaatatggttccgtc
gaagcggcgctggcagccggtaagaccttccatatctgggccaagccgatgctggactcc
tttattttccttgggggcagtggtgcgactttaggcctgatcctggctatctttatcgcc
tctcgccgtgctgattatcgtcaggtggcaaaactggcgctgccgtccggcatcttccag
attaacgaaccgattctgtttggtctgccaattatcatgaacccggtgatgtttatcccg
tttgtactggtacaaccgattctggcggcaatcaccctcgcagcgtactacatgggcatt
attcctccggtgaccaatattgcaccgtggaccatgccaaccggtctgggagccttcttt
aacaccaacggtagcgtcgccgcattgctggtcgcactcttcaaccttggcatcgcaacg
ttaatttatctgccctttgttgtggtggctaacaaagcacaaaatgcgattgataaagaa
gagagcgaagaagatatcgctaacgccctgaaattttaa

DBGET integrated database retrieval system